BLASTX nr result
ID: Chrysanthemum22_contig00049227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00049227 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023742280.1| pectinesterase inhibitor 7-like [Lactuca sat... 64 6e-10 gb|OTF93166.1| putative pectinesterase inhibitor domain-containi... 59 5e-09 gb|KVH97678.1| Pectinesterase inhibitor [Cynara cardunculus var.... 61 5e-09 ref|XP_022015550.1| pectinesterase inhibitor 7-like [Helianthus ... 59 6e-08 ref|XP_022022559.1| pectinesterase inhibitor 11-like [Helianthus... 57 3e-07 >ref|XP_023742280.1| pectinesterase inhibitor 7-like [Lactuca sativa] gb|PLY67328.1| hypothetical protein LSAT_4X13401 [Lactuca sativa] Length = 204 Score = 63.9 bits (154), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 346 GVKADVCGRAVKVKEVTSNALALVNGFANTIQ 251 G+KADVCGRAVKVKEVTSNALALVNGFANTIQ Sbjct: 171 GLKADVCGRAVKVKEVTSNALALVNGFANTIQ 202 >gb|OTF93166.1| putative pectinesterase inhibitor domain-containing protein [Helianthus annuus] Length = 76 Score = 58.5 bits (140), Expect = 5e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 346 GVKADVCGRAVKVKEVTSNALALVNGFANTIQTP 245 G+K DVCGRAVKVKEVTSNALALVN F +TI TP Sbjct: 43 GIKDDVCGRAVKVKEVTSNALALVNRFVDTIHTP 76 >gb|KVH97678.1| Pectinesterase inhibitor [Cynara cardunculus var. scolymus] Length = 196 Score = 61.2 bits (147), Expect = 5e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 346 GVKADVCGRAVKVKEVTSNALALVNGFANTIQTP 245 GVKA+VC RAVKVKEVTSNALALVN FAN IQTP Sbjct: 163 GVKAEVCDRAVKVKEVTSNALALVNSFANAIQTP 196 >ref|XP_022015550.1| pectinesterase inhibitor 7-like [Helianthus annuus] Length = 205 Score = 58.5 bits (140), Expect = 6e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 346 GVKADVCGRAVKVKEVTSNALALVNGFANTIQTP 245 G+K DVCGRAVKVKEVTSNALALVN F +TI TP Sbjct: 172 GIKDDVCGRAVKVKEVTSNALALVNRFVDTIHTP 205 >ref|XP_022022559.1| pectinesterase inhibitor 11-like [Helianthus annuus] gb|OTF87881.1| putative plant invertase/pectin methylesterase inhibitor superfamily protein [Helianthus annuus] Length = 208 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 343 VKADVCGRAVKVKEVTSNALALVNGFANTIQTP 245 VK DVC RAVKVKEVTSNALAL+N FA++IQTP Sbjct: 176 VKTDVCERAVKVKEVTSNALALINSFASSIQTP 208