BLASTX nr result
ID: Chrysanthemum22_contig00049179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00049179 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014569072.1| hypothetical protein L969DRAFT_16442 [Mixia ... 56 3e-07 >ref|XP_014569072.1| hypothetical protein L969DRAFT_16442 [Mixia osmundae IAM 14324] dbj|GAA94218.1| hypothetical protein E5Q_00867 [Mixia osmundae IAM 14324] gb|KEI41091.1| hypothetical protein L969DRAFT_16442 [Mixia osmundae IAM 14324] Length = 116 Score = 56.2 bits (134), Expect = 3e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 143 KGTQRQGPGGTSTKASDVQGASDKFGNVVGNGAEQDKLKTNSN 271 +GT+R G G ST+A DVQGASDK+G VVG+ EQDKLK++ + Sbjct: 72 QGTERHGTKGPSTRAIDVQGASDKYGAVVGSSEEQDKLKSSKS 114