BLASTX nr result
ID: Chrysanthemum22_contig00048348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00048348 (1089 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAM36311.1| hypothetical protein [Thermobia domestica] 74 3e-13 gb|ABK26259.1| unknown [Picea sitchensis] 54 3e-06 >emb|CAM36311.1| hypothetical protein [Thermobia domestica] Length = 53 Score = 73.9 bits (180), Expect = 3e-13 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 286 IIRLSYLRDNSVIFLESSY**KSLRPRCWIKIGNRSRRLLTRSVRPLNFYMI 131 I+RLSYLRDNSVIF E+SY + LRPRCWIKI +R R L+ RSVRPL YMI Sbjct: 2 IVRLSYLRDNSVIFFENSYRQERLRPRCWIKILSRCRSLVYRSVRPLKSYMI 53 >gb|ABK26259.1| unknown [Picea sitchensis] Length = 42 Score = 53.9 bits (128), Expect = 3e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 286 IIRLSYLRDNSVIFLESSY**KSLRPRCWIKIGNRSRRL 170 I RL+YLRDNSVIF SSY KSLRPRCWIKI R + L Sbjct: 2 IKRLNYLRDNSVIFFFSSYKKKSLRPRCWIKIKFRCKSL 40