BLASTX nr result
ID: Chrysanthemum22_contig00048266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00048266 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022029868.1| root allergen protein-like [Helianthus annuu... 132 2e-36 gb|OTG32804.1| putative ribonuclease 1 [Helianthus annuus] 132 2e-36 gb|KVH96473.1| Bet v I domain-containing protein [Cynara cardunc... 132 4e-36 ref|XP_022029866.1| root allergen protein-like [Helianthus annuu... 131 9e-36 gb|KVH96493.1| Bet v I domain-containing protein [Cynara cardunc... 130 2e-35 gb|KVH96487.1| Bet v I domain-containing protein [Cynara cardunc... 129 4e-35 gb|KVH96458.1| Bet v I domain-containing protein, partial [Cynar... 129 4e-35 gb|KVH96455.1| Bet v I domain-containing protein [Cynara cardunc... 129 5e-35 ref|XP_022029867.1| root allergen protein-like [Helianthus annuu... 129 5e-35 gb|KVH96457.1| Bet v I domain-containing protein [Cynara cardunc... 129 7e-35 gb|KVH96485.1| Bet v I domain-containing protein [Cynara cardunc... 128 1e-34 gb|OTG32770.1| putative START-like domain, Major latex protein d... 132 1e-34 ref|XP_022005063.1| root allergen protein-like [Helianthus annuu... 128 1e-34 gb|OTG32768.1| putative bet v I/Major latex protein, START-like ... 128 2e-34 ref|XP_022027080.1| root allergen protein-like isoform X1 [Helia... 127 4e-34 gb|KVH96492.1| hypothetical protein Ccrd_001420 [Cynara carduncu... 126 6e-34 gb|KVH96488.1| Bet v I domain-containing protein [Cynara cardunc... 126 6e-34 gb|KVH96489.1| Bet v I domain-containing protein [Cynara cardunc... 129 2e-33 gb|KVH96454.1| hypothetical protein Ccrd_001456 [Cynara carduncu... 125 2e-33 ref|XP_021998129.1| root allergen protein-like [Helianthus annuu... 124 3e-33 >ref|XP_022029868.1| root allergen protein-like [Helianthus annuus] ref|XP_022029900.1| root allergen protein-like [Helianthus annuus] Length = 159 Score = 132 bits (333), Expect = 2e-36 Identities = 61/90 (67%), Positives = 71/90 (78%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNFTY+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDASNFTYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 + LNFEK YEKTYKA+EAY AAHPE+Y Sbjct: 129 PVDVLNFEKELYEKTYKAMEAYAAAHPEVY 158 >gb|OTG32804.1| putative ribonuclease 1 [Helianthus annuus] Length = 159 Score = 132 bits (333), Expect = 2e-36 Identities = 61/90 (67%), Positives = 71/90 (78%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNFTY+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDASNFTYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 + LNFEK YEKTYKA+EAY AAHPE+Y Sbjct: 129 PVDVLNFEKELYEKTYKAMEAYAAAHPEVY 158 >gb|KVH96473.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 158 Score = 132 bits (331), Expect = 4e-36 Identities = 63/90 (70%), Positives = 69/90 (76%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+F+EGD L I DSI H IKI+P DGGS++KQTV YNCKGN KP Sbjct: 69 YKVDAIDTSNFSYSYSFYEGDNLLGILDSIAHHIKIIPCADGGSIFKQTVIYNCKGNDKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L K YEKTYKAIEAY AAHPE Y Sbjct: 129 SEEILKAGKEIYEKTYKAIEAYGAAHPESY 158 >ref|XP_022029866.1| root allergen protein-like [Helianthus annuus] ref|XP_022029869.1| root allergen protein-like [Helianthus annuus] ref|XP_022029901.1| root allergen protein-like [Helianthus annuus] Length = 159 Score = 131 bits (329), Expect = 9e-36 Identities = 61/90 (67%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNF Y+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDVSNFIYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 + LNFEK YEKTYKAIEAY AAHPE+Y Sbjct: 129 PVDVLNFEKELYEKTYKAIEAYAAAHPEVY 158 >gb|KVH96493.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 157 Score = 130 bits (327), Expect = 2e-35 Identities = 66/90 (73%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+FFEGD L I DSITH IKIVP DGGS +KQTV YNCKG+ KP Sbjct: 69 YKVDAIDTSNFSYSYSFFEGDCLMGILDSITHHIKIVPC-DGGSKFKQTVIYNCKGSDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKTYKAIEAY AAHPE Y Sbjct: 128 SEEILKAEKEIYEKTYKAIEAYGAAHPESY 157 >gb|KVH96487.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 158 Score = 129 bits (325), Expect = 4e-35 Identities = 60/90 (66%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+Y+Y+FFEGD L I DSIT+ I IVP+ DGGS++KQT+ YNCKGN KP Sbjct: 69 YKVDAIDASNFSYTYSFFEGDNLMGILDSITNQITIVPSADGGSIFKQTIIYNCKGNEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKT+KAIEAY AHP+ Y Sbjct: 129 SEEVLKIEKDIYEKTFKAIEAYGVAHPDNY 158 >gb|KVH96458.1| Bet v I domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 141 Score = 129 bits (323), Expect = 4e-35 Identities = 64/90 (71%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+FF+GD L I DSITH IK+VP DGGS +KQTV YNCKG+ KP Sbjct: 53 YKVDAIDTSNFSYSYSFFDGDCLMGILDSITHHIKVVPC-DGGSKFKQTVIYNCKGSDKP 111 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKTYKAIEAY AAHPE Y Sbjct: 112 SEEILKTEKEIYEKTYKAIEAYGAAHPESY 141 >gb|KVH96455.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 157 Score = 129 bits (324), Expect = 5e-35 Identities = 64/90 (71%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+FF+GD L I DSITH IK+VP DGGS +KQTV YNCKGN KP Sbjct: 69 YKVDAIDTSNFSYSYSFFDGDCLMGILDSITHHIKVVPC-DGGSKFKQTVIYNCKGNDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKT+KAIEAY AAHPE Y Sbjct: 128 SEEILKAEKEIYEKTFKAIEAYGAAHPESY 157 >ref|XP_022029867.1| root allergen protein-like [Helianthus annuus] gb|OTG32769.1| putative START-like domain, Bet v I type allergen [Helianthus annuus] Length = 159 Score = 129 bits (324), Expect = 5e-35 Identities = 60/90 (66%), Positives = 69/90 (76%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNF Y+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDASNFIYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 + L FEK YEKTYKAIEAY AAHPE+Y Sbjct: 129 PVDVLTFEKELYEKTYKAIEAYAAAHPEVY 158 >gb|KVH96457.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] gb|KVH96474.1| hypothetical protein Ccrd_001440 [Cynara cardunculus var. scolymus] Length = 157 Score = 129 bits (323), Expect = 7e-35 Identities = 64/90 (71%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+FF+GD L I DSITH IK+VP DGGS +KQTV YNCKG+ KP Sbjct: 69 YKVDAIDTSNFSYSYSFFDGDCLMGILDSITHHIKVVPC-DGGSKFKQTVIYNCKGSDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKTYKAIEAY AAHPE Y Sbjct: 128 SEEILKAEKEIYEKTYKAIEAYGAAHPESY 157 >gb|KVH96485.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 157 Score = 128 bits (322), Expect = 1e-34 Identities = 61/90 (67%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D NF+Y+Y+FFEGD L I DSI H IK++P DGGS++KQTVTYNCKG+ KP Sbjct: 69 YKVDAIDAGNFSYNYSFFEGDSLMGILDSINHHIKVIPT-DGGSIFKQTVTYNCKGSDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SE+ L EK YEKTYKAIEAY AAHPE Y Sbjct: 128 SEDILKAEKEIYEKTYKAIEAYGAAHPETY 157 >gb|OTG32770.1| putative START-like domain, Major latex protein domain, Bet v I type allergen [Helianthus annuus] Length = 320 Score = 132 bits (333), Expect = 1e-34 Identities = 61/90 (67%), Positives = 71/90 (78%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNFTY+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 230 FKQDVIDASNFTYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 289 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 + LNFEK YEKTYKA+EAY AAHPE+Y Sbjct: 290 PVDVLNFEKELYEKTYKAMEAYAAAHPEVY 319 Score = 128 bits (321), Expect = 9e-33 Identities = 60/88 (68%), Positives = 68/88 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNF Y+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDVSNFIYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPE 264 + LNFEK YEKTYKAIEAY AAHPE Sbjct: 129 PVDVLNFEKELYEKTYKAIEAYAAAHPE 156 >ref|XP_022005063.1| root allergen protein-like [Helianthus annuus] gb|OTG02965.1| putative START-like domain, Bet v I type allergen [Helianthus annuus] Length = 158 Score = 128 bits (321), Expect = 1e-34 Identities = 59/90 (65%), Positives = 68/90 (75%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YK D +NF+Y+Y+FFEGD L I DSI H + IVP+ DGGSV+KQTV YNCKG+ KP Sbjct: 69 YKQGAIDATNFSYNYSFFEGDNLMGILDSIDHYVNIVPSADGGSVFKQTVIYNCKGDDKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 S + LNFEK YEKTYKAIEAY AHPE Y Sbjct: 129 SADILNFEKEIYEKTYKAIEAYAVAHPETY 158 >gb|OTG32768.1| putative bet v I/Major latex protein, START-like domain, Bet v I type allergen [Helianthus annuus] Length = 160 Score = 128 bits (321), Expect = 2e-34 Identities = 60/88 (68%), Positives = 68/88 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K DV D SNF Y+YTFFEGD L I DSI H +KIVP+ +GG V+KQTV YNCKG+ KP Sbjct: 69 FKQDVIDVSNFIYNYTFFEGDNLMGILDSINHHVKIVPSAEGGCVFKQTVIYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPE 264 + LNFEK YEKTYKAIEAY AAHPE Sbjct: 129 PVDVLNFEKELYEKTYKAIEAYAAAHPE 156 >ref|XP_022027080.1| root allergen protein-like isoform X1 [Helianthus annuus] gb|OTG32766.1| putative START-like domain, Bet v I type allergen [Helianthus annuus] Length = 158 Score = 127 bits (318), Expect = 4e-34 Identities = 59/90 (65%), Positives = 65/90 (72%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 +K D D NF YSYTFFEGD L I DSI H +K++P D G V+KQ V YNCKG+ KP Sbjct: 69 FKQDAIDEINFVYSYTFFEGDNLMGILDSINHYVKVIPTDDEGCVFKQIVVYNCKGDEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 S E LNFEK YEKTYKAIEAY AAHPE Y Sbjct: 129 STEFLNFEKELYEKTYKAIEAYAAAHPEAY 158 >gb|KVH96492.1| hypothetical protein Ccrd_001420 [Cynara cardunculus var. scolymus] Length = 157 Score = 126 bits (317), Expect = 6e-34 Identities = 63/90 (70%), Positives = 69/90 (76%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+YSY+FF+GD L I DSITH IK+VP DGGS +KQTV YNCK + KP Sbjct: 69 YKVDAIDTSNFSYSYSFFDGDCLMGILDSITHHIKVVPC-DGGSKFKQTVIYNCKSSDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKTYKAIEAY AAHPE Y Sbjct: 128 SEEILKAEKEIYEKTYKAIEAYGAAHPESY 157 >gb|KVH96488.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 158 Score = 126 bits (317), Expect = 6e-34 Identities = 59/90 (65%), Positives = 68/90 (75%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF Y+Y+FFEGD L I DSIT+ +KI+P+ DGGS++KQTV YNCKG KP Sbjct: 69 YKVDAIDASNFCYTYSFFEGDNLMGILDSITNHVKIIPSADGGSIFKQTVIYNCKGAEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKT+KAIEAY AH E Y Sbjct: 129 SEEVLKIEKETYEKTFKAIEAYGVAHSENY 158 >gb|KVH96489.1| Bet v I domain-containing protein [Cynara cardunculus var. scolymus] Length = 311 Score = 129 bits (325), Expect = 2e-33 Identities = 60/89 (67%), Positives = 70/89 (78%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+Y+Y+FFEGD L I DSIT+ I IVP+ DGGS++KQT+ YNCKGN KP Sbjct: 69 YKVDAIDASNFSYTYSFFEGDNLMGILDSITNQITIVPSADGGSIFKQTIIYNCKGNEKP 128 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPEL 267 SEE L EK YEKT+KAIEAY AHPE+ Sbjct: 129 SEEVLKIEKDIYEKTFKAIEAYGIAHPEI 157 Score = 129 bits (324), Expect = 3e-33 Identities = 60/90 (66%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D +NF+Y+Y+FFEGD L I DSIT+ I IVP+ DGGS++KQT+ YNCKGN KP Sbjct: 222 YKVDAIDANNFSYTYSFFEGDNLMGILDSITNQITIVPSADGGSIFKQTIIYNCKGNDKP 281 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK YEKT+KAIEAY AHPE Y Sbjct: 282 SEEVLKIEKEIYEKTFKAIEAYGVAHPENY 311 >gb|KVH96454.1| hypothetical protein Ccrd_001456 [Cynara cardunculus var. scolymus] Length = 157 Score = 125 bits (313), Expect = 2e-33 Identities = 60/90 (66%), Positives = 70/90 (77%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD D SNF+Y+Y+FFEGD L I DSI H IK+VP DGGS++KQTV YNCKG+ KP Sbjct: 69 YKVDAIDTSNFSYNYSFFEGDCLMGILDSINHHIKVVPT-DGGSIFKQTVIYNCKGSDKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SE+ L EK YEKTYKAIEA+ AAHP+ Y Sbjct: 128 SEDILKAEKEIYEKTYKAIEAHGAAHPDTY 157 >ref|XP_021998129.1| root allergen protein-like [Helianthus annuus] gb|OTG05384.1| putative START-like domain, Major latex protein domain, Bet v I type allergen [Helianthus annuus] Length = 157 Score = 124 bits (312), Expect = 3e-33 Identities = 58/90 (64%), Positives = 66/90 (73%) Frame = +1 Query: 1 YKVDVYDPSNFTYSYTFFEGDYLQDIADSITHIIKIVPAGDGGSVYKQTVTYNCKGNAKP 180 YKVD DPSN++Y Y+ EGD L I DSI H +KIVP+ DGGSVYKQTV YNCKG KP Sbjct: 68 YKVDAVDPSNYSYDYSIIEGDSLIGILDSINHHVKIVPSSDGGSVYKQTVVYNCKGAEKP 127 Query: 181 SEEALNFEKSEYEKTYKAIEAYTAAHPELY 270 SEE L EK +E +KAIEAY AHPE+Y Sbjct: 128 SEEFLKTEKEVFESNFKAIEAYAVAHPEVY 157