BLASTX nr result
ID: Chrysanthemum22_contig00047978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047978 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI01824.1| Armadillo-like helical [Cynara cardunculus var. s... 62 4e-08 ref|XP_023750670.1| putative pumilio homolog 8, chloroplastic [L... 61 1e-07 ref|XP_021981841.1| putative pumilio homolog 8, chloroplastic [H... 55 9e-06 >gb|KVI01824.1| Armadillo-like helical [Cynara cardunculus var. scolymus] Length = 674 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 103 MVERIDITNENMKDDDELEMLLGEIPHATSSFH 5 MVERI+ITNENMKDDDELE+LLGEIPHATS H Sbjct: 1 MVERIEITNENMKDDDELELLLGEIPHATSLSH 33 >ref|XP_023750670.1| putative pumilio homolog 8, chloroplastic [Lactuca sativa] Length = 621 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 103 MVERIDITNENMKDDDELEMLLGEIPHATSS 11 MVERI+ITNEN+KDDDELE+LLGEIPHATSS Sbjct: 1 MVERIEITNENIKDDDELELLLGEIPHATSS 31 >ref|XP_021981841.1| putative pumilio homolog 8, chloroplastic [Helianthus annuus] gb|OTG14459.1| putative armadillo-type fold protein [Helianthus annuus] Length = 558 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 103 MVERIDITNENMKDDDELEMLLGEIPHATSSFHV 2 MVERI++TNE KDDDELEMLL EIPHAT+S ++ Sbjct: 1 MVERIEVTNERSKDDDELEMLLDEIPHATASLNL 34