BLASTX nr result
ID: Chrysanthemum22_contig00047589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047589 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023753054.1| uncharacterized protein LOC111901436 isoform... 58 6e-08 ref|XP_023753053.1| uncharacterized protein LOC111901436 isoform... 58 6e-08 ref|XP_021982745.1| uncharacterized protein LOC110878700 [Helian... 54 1e-06 >ref|XP_023753054.1| uncharacterized protein LOC111901436 isoform X2 [Lactuca sativa] Length = 169 Score = 58.2 bits (139), Expect = 6e-08 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +2 Query: 245 P*SAETASKILE*EMLQVTL--PKHGNAHPQRVVSAVPLKSGF 367 P S ETASKILE EML+VTL PK+GNA QRVVS VPLKSGF Sbjct: 113 PFSGETASKILEGEMLKVTLSKPKNGNAQHQRVVSVVPLKSGF 155 >ref|XP_023753053.1| uncharacterized protein LOC111901436 isoform X1 [Lactuca sativa] gb|PLY93601.1| hypothetical protein LSAT_2X96660 [Lactuca sativa] Length = 172 Score = 58.2 bits (139), Expect = 6e-08 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +2 Query: 245 P*SAETASKILE*EMLQVTL--PKHGNAHPQRVVSAVPLKSGF 367 P S ETASKILE EML+VTL PK+GNA QRVVS VPLKSGF Sbjct: 113 PFSGETASKILEGEMLKVTLSKPKNGNAQHQRVVSVVPLKSGF 155 >ref|XP_021982745.1| uncharacterized protein LOC110878700 [Helianthus annuus] gb|OTG15343.1| hypothetical protein HannXRQ_Chr09g0259381 [Helianthus annuus] Length = 152 Score = 54.3 bits (129), Expect = 1e-06 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +2 Query: 203 DFFNFWVEKAMPNT-P*SAETASKILE*EMLQVTL--PKHGNAHPQRVVSAVPLKSGF 367 DFFNF NT P S ET S+ILE EML+VTL P++GNA RVVS +PL+SGF Sbjct: 84 DFFNF------TNTHPFSGETVSRILEGEMLRVTLSNPRNGNAQHLRVVSVIPLRSGF 135