BLASTX nr result
ID: Chrysanthemum22_contig00047529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047529 (798 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021985066.1| uncharacterized protein LOC110880962 [Helian... 55 7e-06 >ref|XP_021985066.1| uncharacterized protein LOC110880962 [Helianthus annuus] Length = 160 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -2 Query: 536 AAVYYIWQERNFRLFQKEFRSADTVFKLIVDMVRLKLMGLEIRYSAEVEKGGLMSFLLMV 357 A+ Y IWQERN RLF+ + R DT+ LI++MVR KL+G++ + + V++ Sbjct: 94 ASAYVIWQERNMRLFKNQTRPPDTIASLILNMVRYKLLGVKFKSTVRVKR---------- 143 Query: 356 LLDSW 342 LLD W Sbjct: 144 LLDDW 148