BLASTX nr result
ID: Chrysanthemum22_contig00047199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047199 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWM62613.1| hypothetical protein CDL15_Pgr000002 [Punica gran... 77 8e-16 gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium r... 61 3e-09 ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago... 60 2e-08 >gb|OWM62613.1| hypothetical protein CDL15_Pgr000002 [Punica granatum] Length = 63 Score = 76.6 bits (187), Expect = 8e-16 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 206 MNLSRWRKGIAMDSYGASRNKQIQSDDEFLRGKRK*KVRFHD 331 MNLSRWRKGIAMDSYGASRNK+I SDDEFLRG RK KV FHD Sbjct: 1 MNLSRWRKGIAMDSYGASRNKKIVSDDEFLRGPRKSKVVFHD 42 >gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium raimondii] Length = 100 Score = 60.8 bits (146), Expect = 3e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 206 MNLSRWRKGIAMDSYGASRNKQIQSDDEFLRGKRK*K 316 MNLSRWRKGIA++SY AS+NK+++SDDEFLRG RK K Sbjct: 1 MNLSRWRKGIAINSYRASKNKKMKSDDEFLRGPRKSK 37 >ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] gb|KEH16851.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] Length = 172 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 237 RWIPMEHPGTSRFNRTTNSYVEKGNKRSASTI 332 RWIPM+H GT RFNRTTNSYV +GNKRSASTI Sbjct: 94 RWIPMKHSGTRRFNRTTNSYVVQGNKRSASTI 125