BLASTX nr result
ID: Chrysanthemum22_contig00047118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047118 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90764.1| Cyclic nucleotide-binding domain-containing prote... 87 1e-16 ref|XP_022026359.1| protein CNGC15b-like [Helianthus annuus] >gi... 83 2e-15 ref|XP_023749452.1| protein CNGC15b-like [Lactuca sativa] 79 7e-14 gb|KVI09348.1| Cyclic nucleotide-binding domain-containing prote... 67 7e-10 ref|XP_016483627.1| PREDICTED: putative cyclic nucleotide-gated ... 67 9e-10 ref|XP_009788225.1| PREDICTED: putative cyclic nucleotide-gated ... 67 1e-09 gb|PHT69273.1| putative cyclic nucleotide-gated ion channel 15 [... 66 1e-09 gb|PHT35141.1| hypothetical protein CQW23_26941 [Capsicum baccatum] 66 1e-09 ref|XP_016548568.1| PREDICTED: putative cyclic nucleotide-gated ... 66 1e-09 ref|XP_019255416.1| PREDICTED: protein CNGC15b [Nicotiana attenu... 64 6e-09 ref|XP_009611941.1| PREDICTED: protein CNGC15b-like [Nicotiana t... 64 6e-09 ref|XP_010313416.1| PREDICTED: protein CNGC15b [Solanum lycopers... 64 1e-08 ref|XP_015056668.1| PREDICTED: putative cyclic nucleotide-gated ... 62 3e-08 gb|PLY61886.1| hypothetical protein LSAT_6X45540 [Lactuca sativa] 62 3e-08 ref|XP_006340177.1| PREDICTED: putative cyclic nucleotide-gated ... 62 4e-08 ref|XP_023753118.1| protein CNGC15b-like [Lactuca sativa] 61 7e-08 ref|XP_021627367.1| protein CNGC15b [Manihot esculenta] >gi|1035... 59 3e-07 gb|PIN07660.1| K+-channel ERG [Handroanthus impetiginosus] 59 6e-07 ref|XP_022883440.1| protein CNGC15b-like [Olea europaea var. syl... 57 2e-06 ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phas... 57 2e-06 >gb|KVH90764.1| Cyclic nucleotide-binding domain-containing protein [Cynara cardunculus var. scolymus] Length = 686 Score = 86.7 bits (213), Expect = 1e-16 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMPGTRKPEKRPE 480 M+YAN+RSVRFQDD + PK+Q VNGDN+FKVKYNIDGKQ+P +RKPEKR E Sbjct: 1 MSYANSRSVRFQDDIEPPKFQSVNGDNMFKVKYNIDGKQLPESRKPEKRIE 51 >ref|XP_022026359.1| protein CNGC15b-like [Helianthus annuus] gb|OTG35351.1| putative IQ motif, EF-hand binding site, Potassium channel, voltage-dependent, EAG/ELK/ERG [Helianthus annuus] Length = 710 Score = 82.8 bits (203), Expect = 2e-15 Identities = 37/51 (72%), Positives = 46/51 (90%), Gaps = 1/51 (1%) Frame = +1 Query: 328 MAYANTRSVRFQDDADL-PKYQPVNGDNLFKVKYNIDGKQMPGTRKPEKRP 477 M+YANTRSVRFQ+D + PK+QP+NGD+LFKVKYNIDGKQ+P +RKP+ RP Sbjct: 1 MSYANTRSVRFQEDVEQQPKFQPINGDSLFKVKYNIDGKQIPESRKPDNRP 51 >ref|XP_023749452.1| protein CNGC15b-like [Lactuca sativa] Length = 695 Score = 78.6 bits (192), Expect = 7e-14 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMPGTRKPEKRPE 480 M+YAN+RSVRFQD+ +LPK+Q +N D+LFKVKYNI+ KQ+P TR PEKR E Sbjct: 1 MSYANSRSVRFQDEVELPKFQSINADDLFKVKYNIEAKQIPETRIPEKRIE 51 >gb|KVI09348.1| Cyclic nucleotide-binding domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 684 Score = 67.0 bits (162), Expect = 7e-10 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMPGTRKPEKRP 477 MAYAN+RSVRF DD ++ K + DNLFKVKYN+DGKQ+P R EK P Sbjct: 1 MAYANSRSVRFHDDIEVSKLPSMKKDNLFKVKYNLDGKQVPEQRMEEKSP 50 >ref|XP_016483627.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15, partial [Nicotiana tabacum] Length = 613 Score = 66.6 bits (161), Expect = 9e-10 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP--GTRKPEK 471 MAY N+RSVRFQDD D KY +NGDNL KVKY IDG ++P +RK EK Sbjct: 1 MAYGNSRSVRFQDDLDTTKYATINGDNLIKVKYKIDGSRLPELASRKNEK 50 >ref|XP_009788225.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana sylvestris] Length = 710 Score = 66.6 bits (161), Expect = 1e-09 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP--GTRKPEK 471 MAY N+RSVRFQDD D KY +NGDNL KVKY IDG ++P +RK EK Sbjct: 1 MAYGNSRSVRFQDDLDTTKYATINGDNLIKVKYKIDGSRLPELASRKNEK 50 >gb|PHT69273.1| putative cyclic nucleotide-gated ion channel 15 [Capsicum annuum] gb|PHU03879.1| putative cyclic nucleotide-gated ion channel 15 [Capsicum chinense] Length = 706 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM---PGTRKPEKRPE 480 MAY N+RSVRFQDD + KY +NGDN+ KVKY IDG ++ PG+R EK P+ Sbjct: 1 MAYGNSRSVRFQDDLESTKYATMNGDNVIKVKYKIDGSRLPEPPGSRMSEKEPD 54 >gb|PHT35141.1| hypothetical protein CQW23_26941 [Capsicum baccatum] Length = 706 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM---PGTRKPEKRPE 480 MAY N+RSVRFQDD + KY +NGDN+ KVKY IDG ++ PG+R EK P+ Sbjct: 1 MAYGNSRSVRFQDDLESTKYATMNGDNVIKVKYKIDGSRLPEPPGSRMSEKEPD 54 >ref|XP_016548568.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] ref|XP_016548569.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] ref|XP_016548571.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] ref|XP_016548572.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Capsicum annuum] Length = 706 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM---PGTRKPEKRPE 480 MAY N+RSVRFQDD + KY +NGDN+ KVKY IDG ++ PG+R EK P+ Sbjct: 1 MAYGNSRSVRFQDDLESTKYATMNGDNVIKVKYKIDGSRLPEPPGSRMSEKEPD 54 >ref|XP_019255416.1| PREDICTED: protein CNGC15b [Nicotiana attenuata] ref|XP_019255417.1| PREDICTED: protein CNGC15b [Nicotiana attenuata] gb|OIS96583.1| putative cyclic nucleotide-gated ion channel 15 [Nicotiana attenuata] Length = 710 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP--GTRKPEK 471 MAY N+RSVRFQDD + KY +NGDNL KVKY IDG ++P RK EK Sbjct: 1 MAYGNSRSVRFQDDLESTKYATINGDNLIKVKYKIDGSRLPELANRKNEK 50 >ref|XP_009611941.1| PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] ref|XP_016453101.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana tabacum] ref|XP_018629387.1| PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] Length = 710 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP--GTRKPEK 471 MAY N+RSVRFQDD + K+ +NGDNL KVKY IDG Q+P RK EK Sbjct: 1 MAYGNSRSVRFQDDLESTKFATINGDNLIKVKYKIDGSQLPELANRKNEK 50 >ref|XP_010313416.1| PREDICTED: protein CNGC15b [Solanum lycopersicum] Length = 707 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM--PGTRKPEKRP 477 MAY N+RSVRFQDD + KY +NGDN+ KVKYNIDG ++ P +R E P Sbjct: 1 MAYGNSRSVRFQDDLESSKYAAMNGDNVIKVKYNIDGSRLPEPASRMSEMEP 52 >ref|XP_015056668.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum pennellii] ref|XP_015056669.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum pennellii] Length = 707 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM--PGTRKPEKRPE 480 MAY N+RSVRFQDD + KY +NGDN+ KVKY+IDG ++ P +R E P+ Sbjct: 1 MAYGNSRSVRFQDDLESSKYAAMNGDNVIKVKYSIDGSRLPEPASRMSEMEPD 53 >gb|PLY61886.1| hypothetical protein LSAT_6X45540 [Lactuca sativa] Length = 726 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 358 FQDDADLPKYQPVNGDNLFKVKYNIDGKQMPGTRKPEKRPE 480 FQD+ +LPK+Q +N D+LFKVKYNI+ KQ+P TR PEKR E Sbjct: 42 FQDEVELPKFQSINADDLFKVKYNIEAKQIPETRIPEKRIE 82 >ref|XP_006340177.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] ref|XP_006340178.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] ref|XP_006340179.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Solanum tuberosum] Length = 710 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM--PGTRKPEKRPE 480 MAY N+RSVRFQDD + KY +NGDN+ KVKY IDG ++ P +R E P+ Sbjct: 1 MAYGNSRSVRFQDDLESTKYAAMNGDNVIKVKYKIDGSRLPEPASRMSEMEPD 53 >ref|XP_023753118.1| protein CNGC15b-like [Lactuca sativa] Length = 709 Score = 61.2 bits (147), Expect = 7e-08 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMPGTRKPE 468 M+YAN+RSVRFQDD L K N DNLFK+KYNID KQ+ R E Sbjct: 1 MSYANSRSVRFQDDGGLSKLPSTNKDNLFKIKYNIDNKQVSDQRTEE 47 >ref|XP_021627367.1| protein CNGC15b [Manihot esculenta] gb|OAY38032.1| hypothetical protein MANES_11G147300 [Manihot esculenta] Length = 704 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQM--PGTRKPEK 471 MAY N+RSVRF+DD +L K VNGD++ K+KYNIDG Q+ +RK EK Sbjct: 1 MAYGNSRSVRFKDDLELAKLATVNGDDVIKLKYNIDGTQLSESSSRKSEK 50 >gb|PIN07660.1| K+-channel ERG [Handroanthus impetiginosus] Length = 712 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMPG--TRKPEK 471 MAY+N+RSVRF D+ + K+ NG+NL KVKYNIDG ++ G ++K EK Sbjct: 1 MAYSNSRSVRFHDEVEFAKFSTANGENLIKVKYNIDGTRVQGSSSKKGEK 50 >ref|XP_022883440.1| protein CNGC15b-like [Olea europaea var. sylvestris] Length = 705 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP 450 MAY+N++SVRFQDD +L + NGDNL K KY IDG ++P Sbjct: 1 MAYSNSKSVRFQDDVELANFPTANGDNLIKFKYKIDGTRLP 41 >ref|XP_007150187.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] gb|ESW22181.1| hypothetical protein PHAVU_005G133900g [Phaseolus vulgaris] Length = 696 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 328 MAYANTRSVRFQDDADLPKYQPVNGDNLFKVKYNIDGKQMP 450 MA+ N+RS RF+DD +L K+ NGDN FK+KY+IDG Q+P Sbjct: 1 MAFGNSRSARFEDDPELAKFPASNGDNGFKIKYHIDGTQIP 41