BLASTX nr result
ID: Chrysanthemum22_contig00047080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00047080 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021997946.1| protein IQ-DOMAIN 1-like [Helianthus annuus]... 69 1e-10 gb|OTG05196.1| putative IQ motif, EF-hand binding site [Helianth... 69 1e-10 ref|XP_022001277.1| protein IQ-DOMAIN 1-like [Helianthus annuus] 61 8e-08 gb|OTG01752.1| putative IQ motif, EF-hand binding site [Helianth... 61 8e-08 >ref|XP_021997946.1| protein IQ-DOMAIN 1-like [Helianthus annuus] ref|XP_021997947.1| protein IQ-DOMAIN 1-like [Helianthus annuus] Length = 483 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 142 TKTKSMLPTPTQTKSPSRSPIPSPLGTGKKGAPEKKSSVGPVKK 273 TKTKSM+PTP+ ++SP RSP PSPLG GKKG EKKS+VGP K+ Sbjct: 421 TKTKSMVPTPSHSQSPGRSPSPSPLGFGKKGTVEKKSTVGPAKR 464 >gb|OTG05196.1| putative IQ motif, EF-hand binding site [Helianthus annuus] Length = 503 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 142 TKTKSMLPTPTQTKSPSRSPIPSPLGTGKKGAPEKKSSVGPVKK 273 TKTKSM+PTP+ ++SP RSP PSPLG GKKG EKKS+VGP K+ Sbjct: 441 TKTKSMVPTPSHSQSPGRSPSPSPLGFGKKGTVEKKSTVGPAKR 484 >ref|XP_022001277.1| protein IQ-DOMAIN 1-like [Helianthus annuus] Length = 520 Score = 60.8 bits (146), Expect = 8e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 145 KTKSMLPTPTQTKSPSRSPIPSPLGTGKKGAPEKKSSVGPVKK 273 KTKS +P+PT + SPSRSP PSPLG+G+KG EKK S P K+ Sbjct: 441 KTKSRIPSPTLSPSPSRSPSPSPLGSGRKGTTEKKPSTAPAKR 483 >gb|OTG01752.1| putative IQ motif, EF-hand binding site [Helianthus annuus] Length = 602 Score = 60.8 bits (146), Expect = 8e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 145 KTKSMLPTPTQTKSPSRSPIPSPLGTGKKGAPEKKSSVGPVKK 273 KTKS +P+PT + SPSRSP PSPLG+G+KG EKK S P K+ Sbjct: 523 KTKSRIPSPTLSPSPSRSPSPSPLGSGRKGTTEKKPSTAPAKR 565