BLASTX nr result
ID: Chrysanthemum22_contig00046922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046922 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG03809.1| hypothetical protein HannXRQ_Chr12g0355411 [Helia... 65 2e-09 ref|XP_021999418.1| uncharacterized protein LOC110896276 [Helian... 65 3e-09 >gb|OTG03809.1| hypothetical protein HannXRQ_Chr12g0355411 [Helianthus annuus] Length = 219 Score = 65.1 bits (157), Expect = 2e-09 Identities = 45/134 (33%), Positives = 73/134 (54%) Frame = +1 Query: 58 LDKSHPYLKTVDLQYMHANFNIHNDTVSLEKV*VSLQVDFGKTNTVKVLPEFSTHTISIE 237 L+ P LK++D Q + + NDTV LE V + L+V F + +K P+ T +S Sbjct: 63 LETEQPLLKSIDTQNVSVS-GYKNDTVPLE-VKLGLRVSFNVPDNLKAYPKLGTFVLSTF 120 Query: 238 VDKSRTLRAVSHAPYQISGNGQLIVVEFEPTKINLQEEQLRVFQQRLDKGHM*M*INNDF 417 ++ T RA +++PY+IS + QLI++ F QL Q +L M + ++ DF Sbjct: 121 ENRYYTRRAFTNSPYKISQDDQLILLNF----------QLGDLQMKLYDELMWIKVSGDF 170 Query: 418 KMQLRLARFIPFPQ 459 KM +++A+F FPQ Sbjct: 171 KMIVKIAKFPLFPQ 184 >ref|XP_021999418.1| uncharacterized protein LOC110896276 [Helianthus annuus] Length = 229 Score = 65.1 bits (157), Expect = 3e-09 Identities = 45/134 (33%), Positives = 73/134 (54%) Frame = +1 Query: 58 LDKSHPYLKTVDLQYMHANFNIHNDTVSLEKV*VSLQVDFGKTNTVKVLPEFSTHTISIE 237 L+ P LK++D Q + + NDTV LE V + L+V F + +K P+ T +S Sbjct: 73 LETEQPLLKSIDTQNVSVS-GYKNDTVPLE-VKLGLRVSFNVPDNLKAYPKLGTFVLSTF 130 Query: 238 VDKSRTLRAVSHAPYQISGNGQLIVVEFEPTKINLQEEQLRVFQQRLDKGHM*M*INNDF 417 ++ T RA +++PY+IS + QLI++ F QL Q +L M + ++ DF Sbjct: 131 ENRYYTRRAFTNSPYKISQDDQLILLNF----------QLGDLQMKLYDELMWIKVSGDF 180 Query: 418 KMQLRLARFIPFPQ 459 KM +++A+F FPQ Sbjct: 181 KMIVKIAKFPLFPQ 194