BLASTX nr result
ID: Chrysanthemum22_contig00046886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046886 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019437086.1| PREDICTED: probable mediator of RNA polymera... 57 3e-06 ref|XP_019458617.1| PREDICTED: probable mediator of RNA polymera... 56 7e-06 ref|XP_019433327.1| PREDICTED: probable mediator of RNA polymera... 56 7e-06 >ref|XP_019437086.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] ref|XP_019437087.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] ref|XP_019437088.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] gb|OIW15494.1| hypothetical protein TanjilG_32898 [Lupinus angustifolius] Length = 455 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = -1 Query: 451 MKELSMDRLRESIAKTGVDIFEAIEETIKVAACDLPNEFNIRQPEIAEELFSCKYS 284 MK LS+D R DIFE I I VAA D P EF +R+ +IAE LFSCK S Sbjct: 3 MKSLSLDHWRSYFRSANSDIFEIIHHAIMVAASDCPKEFRLRRDKIAETLFSCKLS 58 >ref|XP_019458617.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] ref|XP_019458618.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] ref|XP_019458619.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b [Lupinus angustifolius] gb|OIW03214.1| hypothetical protein TanjilG_21846 [Lupinus angustifolius] Length = 452 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/54 (51%), Positives = 32/54 (59%) Frame = -1 Query: 451 MKELSMDRLRESIAKTGVDIFEAIEETIKVAACDLPNEFNIRQPEIAEELFSCK 290 MK LS+D R DIFE I+ I VAA D P EF +R+ IAE LFSCK Sbjct: 1 MKSLSLDHWRSYFRSANSDIFEIIDHAIMVAASDCPKEFRLRRDGIAERLFSCK 54 >ref|XP_019433327.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b isoform X1 [Lupinus angustifolius] ref|XP_019433328.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b isoform X1 [Lupinus angustifolius] ref|XP_019433329.1| PREDICTED: probable mediator of RNA polymerase II transcription subunit 26b isoform X2 [Lupinus angustifolius] gb|OIW21573.1| hypothetical protein TanjilG_06350 [Lupinus angustifolius] Length = 457 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/54 (50%), Positives = 34/54 (62%) Frame = -1 Query: 451 MKELSMDRLRESIAKTGVDIFEAIEETIKVAACDLPNEFNIRQPEIAEELFSCK 290 MK LS+D R +DIF+ I+ I VAA D P EF++R+ IAE LFSCK Sbjct: 1 MKSLSLDHWRSYFRSKNLDIFDIIDHAIMVAASDCPKEFSLRRDGIAERLFSCK 54