BLASTX nr result
ID: Chrysanthemum22_contig00046651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046651 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY84400.1| hypothetical protein LSAT_8X56641 [Lactuca sativa] 54 8e-06 ref|XP_023765252.1| late embryogenesis abundant protein D-34-lik... 54 9e-06 >gb|PLY84400.1| hypothetical protein LSAT_8X56641 [Lactuca sativa] Length = 249 Score = 54.3 bits (129), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 28 QEQEPIKYGEVLKVSGGIAN*PITPQDAATMQ 123 ++QEPIKYG+V +VSG IAN PITPQDAATMQ Sbjct: 12 EDQEPIKYGDVFQVSGEIANKPITPQDAATMQ 43 >ref|XP_023765252.1| late embryogenesis abundant protein D-34-like [Lactuca sativa] Length = 257 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 28 QEQEPIKYGEVLKVSGGIAN*PITPQDAATMQ 123 ++QEPIKYG+V +VSG IAN PITPQDAATMQ Sbjct: 12 EDQEPIKYGDVFQVSGEIANKPITPQDAATMQ 43