BLASTX nr result
ID: Chrysanthemum22_contig00046625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046625 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021984373.1| pentatricopeptide repeat-containing protein ... 122 1e-29 gb|PLY76505.1| hypothetical protein LSAT_4X103720 [Lactuca sativa] 117 8e-28 ref|XP_023730406.1| pentatricopeptide repeat-containing protein ... 117 8e-28 ref|XP_023900163.1| pentatricopeptide repeat-containing protein ... 107 6e-27 ref|XP_021610725.1| pentatricopeptide repeat-containing protein ... 108 1e-24 ref|XP_023900173.1| pentatricopeptide repeat-containing protein ... 107 3e-24 gb|PNX83292.1| hypothetical protein L195_g039332, partial [Trifo... 100 3e-24 gb|POE56003.1| pentatricopeptide repeat-containing protein [Quer... 107 4e-24 gb|POO03264.1| Tetratricopeptide-like helical domain containing ... 107 4e-24 ref|XP_023896400.1| pentatricopeptide repeat-containing protein ... 107 4e-24 ref|XP_024022800.1| pentatricopeptide repeat-containing protein ... 107 5e-24 ref|XP_010654675.1| PREDICTED: pentatricopeptide repeat-containi... 106 7e-24 gb|PNT55216.1| hypothetical protein POPTR_001G180000v3 [Populus ... 105 2e-23 ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Popu... 104 3e-23 ref|XP_022714938.1| pentatricopeptide repeat-containing protein ... 104 5e-23 ref|XP_021610720.1| pentatricopeptide repeat-containing protein ... 103 6e-23 ref|XP_017218271.1| PREDICTED: pentatricopeptide repeat-containi... 103 9e-23 ref|XP_012073332.1| pentatricopeptide repeat-containing protein ... 103 9e-23 ref|XP_011002687.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-22 gb|POE56002.1| pentatricopeptide repeat-containing protein [Quer... 102 2e-22 >ref|XP_021984373.1| pentatricopeptide repeat-containing protein At3g16010 [Helianthus annuus] ref|XP_021984374.1| pentatricopeptide repeat-containing protein At3g16010 [Helianthus annuus] gb|OTG16788.1| putative pentatricopeptide repeat (PPR-like) superfamily protein [Helianthus annuus] Length = 642 Score = 122 bits (307), Expect = 1e-29 Identities = 65/87 (74%), Positives = 76/87 (87%), Gaps = 3/87 (3%) Frame = -2 Query: 254 KMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSA 84 KMK+ S RSI TMP+LS+RIKQT+NEIVQMFRLS PR+D+R+LP N +RT R++ SA Sbjct: 3 KMKLHSTPLQRSIFTMPFLSERIKQTENEIVQMFRLSGPRDDTRNLPVN-QRTSRKNNSA 61 Query: 83 RMLDERFIRILKIFKWGPDAEKALEVL 3 R+LDERFIRILKIFKWGPDAEKALEVL Sbjct: 62 RILDERFIRILKIFKWGPDAEKALEVL 88 >gb|PLY76505.1| hypothetical protein LSAT_4X103720 [Lactuca sativa] Length = 634 Score = 117 bits (294), Expect = 8e-28 Identities = 63/83 (75%), Positives = 72/83 (86%) Frame = -2 Query: 251 MKVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLD 72 M + RSI+T +LS+RIKQT+NEIVQMF+LS PREDSR+LP N+RT R+S SARMLD Sbjct: 1 MSISLRRSITTASFLSERIKQTENEIVQMFQLSRPREDSRNLP-TNQRTSRKS-SARMLD 58 Query: 71 ERFIRILKIFKWGPDAEKALEVL 3 ERFIRILKIFKWGPDAEKALEVL Sbjct: 59 ERFIRILKIFKWGPDAEKALEVL 81 >ref|XP_023730406.1| pentatricopeptide repeat-containing protein At3g16010 [Lactuca sativa] Length = 640 Score = 117 bits (294), Expect = 8e-28 Identities = 63/83 (75%), Positives = 72/83 (86%) Frame = -2 Query: 251 MKVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLD 72 M + RSI+T +LS+RIKQT+NEIVQMF+LS PREDSR+LP N+RT R+S SARMLD Sbjct: 7 MSISLRRSITTASFLSERIKQTENEIVQMFQLSRPREDSRNLP-TNQRTSRKS-SARMLD 64 Query: 71 ERFIRILKIFKWGPDAEKALEVL 3 ERFIRILKIFKWGPDAEKALEVL Sbjct: 65 ERFIRILKIFKWGPDAEKALEVL 87 >ref|XP_023900163.1| pentatricopeptide repeat-containing protein At3g16010-like [Quercus suber] gb|POE50991.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 154 Score = 107 bits (268), Expect = 6e-27 Identities = 58/89 (65%), Positives = 71/89 (79%), Gaps = 3/89 (3%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSG 90 +A+M V SI RSIST+ +L +RIKQT+NEIVQMF+LSTP+++ +LP K PR+ Sbjct: 1 MARMIVGSIASKRSISTLSHLCERIKQTENEIVQMFQLSTPKDEMHNLPMRGK-LPRKDP 59 Query: 89 SARMLDERFIRILKIFKWGPDAEKALEVL 3 + R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 AVRTLDERFIRILKIFKWGPDAEKALEVL 88 >ref|XP_021610725.1| pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Manihot esculenta] gb|OAY52934.1| hypothetical protein MANES_04G123300 [Manihot esculenta] Length = 641 Score = 108 bits (270), Expect = 1e-24 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 3/89 (3%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSG 90 +AKM V+SI RSIST+ +L DRIKQT+NEIVQMFRL +++ ++LP N+K + R+ Sbjct: 1 MAKMVVKSIASKRSISTLSHLCDRIKQTENEIVQMFRLPVLKDEKQNLPINSKIS-RKGT 59 Query: 89 SARMLDERFIRILKIFKWGPDAEKALEVL 3 S R+LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 SVRILDERFIRILKIFKWGPDAEKALEVL 88 >ref|XP_023900173.1| pentatricopeptide repeat-containing protein At3g16010-like [Quercus suber] ref|XP_023900174.1| pentatricopeptide repeat-containing protein At3g16010-like [Quercus suber] Length = 641 Score = 107 bits (268), Expect = 3e-24 Identities = 58/89 (65%), Positives = 71/89 (79%), Gaps = 3/89 (3%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSG 90 +A+M V SI RSIST+ +L +RIKQT+NEIVQMF+LSTP+++ +LP K PR+ Sbjct: 1 MARMIVGSIASKRSISTLSHLCERIKQTENEIVQMFQLSTPKDEMHNLPMRGK-LPRKDP 59 Query: 89 SARMLDERFIRILKIFKWGPDAEKALEVL 3 + R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 AVRTLDERFIRILKIFKWGPDAEKALEVL 88 >gb|PNX83292.1| hypothetical protein L195_g039332, partial [Trifolium pratense] Length = 153 Score = 100 bits (250), Expect = 3e-24 Identities = 51/81 (62%), Positives = 63/81 (77%) Frame = -2 Query: 245 VRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDER 66 V + R+IST P+ S R+KQT+NEIVQMF L +E + +LP R R++ +AR+LDER Sbjct: 6 VAARRNISTWPHFSQRLKQTENEIVQMFHLPDSQEANHNLPLKGGRVLRKNPNARILDER 65 Query: 65 FIRILKIFKWGPDAEKALEVL 3 FIRILKIFKWGPDAEKALEVL Sbjct: 66 FIRILKIFKWGPDAEKALEVL 86 >gb|POE56003.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 618 Score = 107 bits (267), Expect = 4e-24 Identities = 57/89 (64%), Positives = 71/89 (79%), Gaps = 3/89 (3%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSG 90 +A+M V SI RSIST+ +L +RIKQT+NE+VQMF+LSTP+++ +LP K PR+ Sbjct: 1 MARMIVGSIASKRSISTLSHLCERIKQTENEVVQMFQLSTPKDEMHNLPMRGK-LPRKDP 59 Query: 89 SARMLDERFIRILKIFKWGPDAEKALEVL 3 + R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 AVRTLDERFIRILKIFKWGPDAEKALEVL 88 >gb|POO03264.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 638 Score = 107 bits (267), Expect = 4e-24 Identities = 52/77 (67%), Positives = 64/77 (83%) Frame = -2 Query: 233 RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDERFIRI 54 RSIST+P+L +R+KQT+NEIVQMF L +PR+ ++ LP N R PR+ S R LDERFIRI Sbjct: 10 RSISTLPHLCERLKQTENEIVQMFHLPSPRDSTKSLPVNG-RLPRKEPSVRKLDERFIRI 68 Query: 53 LKIFKWGPDAEKALEVL 3 L+IFKWGPDAEKA+EVL Sbjct: 69 LRIFKWGPDAEKAMEVL 85 >ref|XP_023896400.1| pentatricopeptide repeat-containing protein At3g16010-like [Quercus suber] Length = 641 Score = 107 bits (267), Expect = 4e-24 Identities = 57/89 (64%), Positives = 71/89 (79%), Gaps = 3/89 (3%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSG 90 +A+M V SI RSIST+ +L +RIKQT+NE+VQMF+LSTP+++ +LP K PR+ Sbjct: 1 MARMIVGSIASKRSISTLSHLCERIKQTENEVVQMFQLSTPKDEMHNLPMRGK-LPRKDP 59 Query: 89 SARMLDERFIRILKIFKWGPDAEKALEVL 3 + R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 AVRTLDERFIRILKIFKWGPDAEKALEVL 88 >ref|XP_024022800.1| pentatricopeptide repeat-containing protein At3g16010 [Morus notabilis] Length = 638 Score = 107 bits (266), Expect = 5e-24 Identities = 54/77 (70%), Positives = 63/77 (81%) Frame = -2 Query: 233 RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDERFIRI 54 RSIST+P+L +R+KQT+NEIVQMF L +P E RDLP N K+ R+ S R LDERF+RI Sbjct: 10 RSISTLPHLCERLKQTENEIVQMFSLRSPSEAMRDLPIN-KKLSRKDPSVRTLDERFVRI 68 Query: 53 LKIFKWGPDAEKALEVL 3 LKIFKWGPDAEKALEVL Sbjct: 69 LKIFKWGPDAEKALEVL 85 >ref|XP_010654675.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Vitis vinifera] emb|CBI36158.3| unnamed protein product, partial [Vitis vinifera] Length = 638 Score = 106 bits (265), Expect = 7e-24 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -2 Query: 233 RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDERFIRI 54 R IST+P+LS RIKQT++EIVQMF+LS+P+++ + LP N K PR + S R LDERFIRI Sbjct: 10 RMISTLPHLSQRIKQTESEIVQMFKLSSPKDEIQRLPMNQK-FPRNNPSVRTLDERFIRI 68 Query: 53 LKIFKWGPDAEKALEVL 3 LKIFKWGPDAEKALEVL Sbjct: 69 LKIFKWGPDAEKALEVL 85 >gb|PNT55216.1| hypothetical protein POPTR_001G180000v3 [Populus trichocarpa] Length = 656 Score = 105 bits (262), Expect = 2e-23 Identities = 53/91 (58%), Positives = 68/91 (74%), Gaps = 1/91 (1%) Frame = -2 Query: 272 ICEMIAKMKVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDS-RDLPDNNKRTPRR 96 + +M+ + S RSIST P+LS RIKQT+ EIV+MF++ + ++D ++LP N + RR Sbjct: 13 MAKMVVLRHIASKRSISTFPFLSQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRR 72 Query: 95 SGSARMLDERFIRILKIFKWGPDAEKALEVL 3 S R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 73 DPSVRTLDERFIRILKIFKWGPDAEKALEVL 103 >ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Populus trichocarpa] Length = 641 Score = 104 bits (260), Expect = 3e-23 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 1/88 (1%) Frame = -2 Query: 263 MIAKMKVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDS-RDLPDNNKRTPRRSGS 87 M+ + S RSIST P+LS RIKQT+ EIV+MF++ + ++D ++LP N + RR S Sbjct: 1 MVVLRHIASKRSISTFPFLSQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRRDPS 60 Query: 86 ARMLDERFIRILKIFKWGPDAEKALEVL 3 R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 61 VRTLDERFIRILKIFKWGPDAEKALEVL 88 >ref|XP_022714938.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] ref|XP_022714939.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] ref|XP_022714940.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] ref|XP_022714941.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] ref|XP_022714942.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] ref|XP_022714943.1| pentatricopeptide repeat-containing protein At3g16010 [Durio zibethinus] Length = 647 Score = 104 bits (259), Expect = 5e-23 Identities = 53/77 (68%), Positives = 62/77 (80%) Frame = -2 Query: 233 RSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDERFIRI 54 RSIST+P+L RIKQT+NEI QMF+L +P + RDL + K PR++ S R LDERFIRI Sbjct: 19 RSISTLPHLCQRIKQTENEIAQMFKLPSPENEVRDLGFSRK-VPRKNPSVRTLDERFIRI 77 Query: 53 LKIFKWGPDAEKALEVL 3 LKIFKWGPDAEKALEVL Sbjct: 78 LKIFKWGPDAEKALEVL 94 >ref|XP_021610720.1| pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Manihot esculenta] ref|XP_021610721.1| pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Manihot esculenta] ref|XP_021610723.1| pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Manihot esculenta] ref|XP_021610724.1| pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Manihot esculenta] Length = 642 Score = 103 bits (258), Expect = 6e-23 Identities = 59/90 (65%), Positives = 73/90 (81%), Gaps = 4/90 (4%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQT-DNEIVQMFRLSTPREDSRDLPDNNKRTPRRS 93 +AKM V+SI RSIST+ +L DRIKQT +NEIVQMFRL +++ ++LP N+K + R+ Sbjct: 1 MAKMVVKSIASKRSISTLSHLCDRIKQTAENEIVQMFRLPVLKDEKQNLPINSKIS-RKG 59 Query: 92 GSARMLDERFIRILKIFKWGPDAEKALEVL 3 S R+LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 TSVRILDERFIRILKIFKWGPDAEKALEVL 89 >ref|XP_017218271.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Daucus carota subsp. sativus] gb|KZM89238.1| hypothetical protein DCAR_026313 [Daucus carota subsp. sativus] Length = 637 Score = 103 bits (257), Expect = 9e-23 Identities = 52/82 (63%), Positives = 67/82 (81%) Frame = -2 Query: 248 KVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDE 69 K+ RS+ST YL RIKQT+++IV+MFRLSTP E++++ N+ + +R+ SAR+LDE Sbjct: 5 KIGLCRSLSTTRYLCQRIKQTESDIVKMFRLSTPSEETQNF-SRNRTSVKRNSSARVLDE 63 Query: 68 RFIRILKIFKWGPDAEKALEVL 3 RFIRILKIFKWGPDAEKALEVL Sbjct: 64 RFIRILKIFKWGPDAEKALEVL 85 >ref|XP_012073332.1| pentatricopeptide repeat-containing protein At3g16010 [Jatropha curcas] ref|XP_020535315.1| pentatricopeptide repeat-containing protein At3g16010 [Jatropha curcas] gb|KDP37204.1| hypothetical protein JCGZ_06260 [Jatropha curcas] Length = 641 Score = 103 bits (257), Expect = 9e-23 Identities = 54/81 (66%), Positives = 65/81 (80%) Frame = -2 Query: 245 VRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDSRDLPDNNKRTPRRSGSARMLDER 66 + S RSIST+P+L +RIKQT+NEIVQMFRL + ++ ++LP N K + R S R LDER Sbjct: 9 IASKRSISTLPHLCERIKQTENEIVQMFRLPSRNDEMQNLPMNRKFS-RNDPSIRKLDER 67 Query: 65 FIRILKIFKWGPDAEKALEVL 3 FIRILKIFKWGPDAEKALEVL Sbjct: 68 FIRILKIFKWGPDAEKALEVL 88 >ref|XP_011002687.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Populus euphratica] Length = 656 Score = 103 bits (256), Expect = 1e-22 Identities = 52/91 (57%), Positives = 67/91 (73%), Gaps = 1/91 (1%) Frame = -2 Query: 272 ICEMIAKMKVRSIRSISTMPYLSDRIKQTDNEIVQMFRLSTPREDS-RDLPDNNKRTPRR 96 + +M+ + S RSIST P+L RIKQT+ EIV+MF++ + ++D ++LP N + RR Sbjct: 13 MAKMVVLRHIASKRSISTFPFLFQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRR 72 Query: 95 SGSARMLDERFIRILKIFKWGPDAEKALEVL 3 S R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 73 DPSVRTLDERFIRILKIFKWGPDAEKALEVL 103 >gb|POE56002.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 619 Score = 102 bits (255), Expect = 2e-22 Identities = 57/90 (63%), Positives = 71/90 (78%), Gaps = 4/90 (4%) Frame = -2 Query: 260 IAKMKVRSI---RSISTMPYLSDRIKQT-DNEIVQMFRLSTPREDSRDLPDNNKRTPRRS 93 +A+M V SI RSIST+ +L +RIKQT +NE+VQMF+LSTP+++ +LP K PR+ Sbjct: 1 MARMIVGSIASKRSISTLSHLCERIKQTAENEVVQMFQLSTPKDEMHNLPMRGK-LPRKD 59 Query: 92 GSARMLDERFIRILKIFKWGPDAEKALEVL 3 + R LDERFIRILKIFKWGPDAEKALEVL Sbjct: 60 PAVRTLDERFIRILKIFKWGPDAEKALEVL 89