BLASTX nr result
ID: Chrysanthemum22_contig00046578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046578 (587 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88933.1| hypothetical protein Ccrd_024668 [Cynara carduncu... 53 5e-06 >gb|KVH88933.1| hypothetical protein Ccrd_024668 [Cynara cardunculus var. scolymus] Length = 90 Score = 53.1 bits (126), Expect = 5e-06 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = +3 Query: 177 CGCDCYRESIRCIQSWQQGTIHVDNNRWLRRLKSPPPPLMWS 302 C CDC ++ R +WQQGTI+ ++N+W +R+K PLMWS Sbjct: 37 CSCDCNCDTTRQNANWQQGTIYTESNKWSKRMKPSSLPLMWS 78