BLASTX nr result
ID: Chrysanthemum22_contig00046486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046486 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021983356.1| inositol hexakisphosphate and diphosphoinosi... 84 2e-16 ref|XP_023753624.1| inositol hexakisphosphate and diphosphoinosi... 82 2e-15 gb|PIA28010.1| hypothetical protein AQUCO_07400097v1 [Aquilegia ... 80 4e-15 gb|PIA28008.1| hypothetical protein AQUCO_07400097v1 [Aquilegia ... 80 4e-15 ref|XP_022005469.1| inositol hexakisphosphate and diphosphoinosi... 77 9e-14 ref|XP_022005465.1| inositol hexakisphosphate and diphosphoinosi... 77 9e-14 ref|XP_023772927.1| inositol hexakisphosphate and diphosphoinosi... 76 1e-13 ref|XP_020551973.1| inositol hexakisphosphate and diphosphoinosi... 75 3e-13 ref|XP_020551972.1| inositol hexakisphosphate and diphosphoinosi... 75 3e-13 ref|XP_011085883.1| inositol hexakisphosphate and diphosphoinosi... 75 3e-13 ref|XP_011085882.1| inositol hexakisphosphate and diphosphoinosi... 75 3e-13 gb|KVI09074.1| Histidine phosphatase superfamily, clade-2 [Cynar... 75 3e-13 gb|OWM69782.1| hypothetical protein CDL15_Pgr025631 [Punica gran... 73 1e-12 gb|OWM69775.1| hypothetical protein CDL15_Pgr025624 [Punica gran... 72 2e-12 ref|XP_011098565.1| inositol hexakisphosphate and diphosphoinosi... 73 2e-12 ref|XP_011098563.1| inositol hexakisphosphate and diphosphoinosi... 73 2e-12 gb|PKI37224.1| hypothetical protein CRG98_042376 [Punica granatum] 72 3e-12 gb|PKI46533.1| hypothetical protein CRG98_033090 [Punica granatum] 69 3e-12 emb|CDP02189.1| unnamed protein product [Coffea canephora] 72 5e-12 ref|XP_022026441.1| inositol hexakisphosphate and diphosphoinosi... 72 5e-12 >ref|XP_021983356.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X4 [Helianthus annuus] Length = 1051 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISNVK 243 AEDFPP TIPQGFSGYFRSAGVLERLVNLWPF+KHGISN K Sbjct: 1011 AEDFPPATIPQGFSGYFRSAGVLERLVNLWPFHKHGISNPK 1051 >ref|XP_023753624.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X4 [Lactuca sativa] Length = 1044 Score = 81.6 bits (200), Expect = 2e-15 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPPTIPQGFSGYF+S GVLERLVNLWPF+KHG S++K Sbjct: 1004 AEDFPPPTIPQGFSGYFKSTGVLERLVNLWPFHKHGYSHLK 1044 >gb|PIA28010.1| hypothetical protein AQUCO_07400097v1 [Aquilegia coerulea] Length = 1055 Score = 80.5 bits (197), Expect = 4e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPF+KH +N K Sbjct: 1015 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFHKHANANGK 1055 >gb|PIA28008.1| hypothetical protein AQUCO_07400097v1 [Aquilegia coerulea] gb|PIA28009.1| hypothetical protein AQUCO_07400097v1 [Aquilegia coerulea] Length = 1061 Score = 80.5 bits (197), Expect = 4e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPF+KH +N K Sbjct: 1021 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFHKHANANGK 1061 >ref|XP_022005469.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X2 [Helianthus annuus] ref|XP_022005470.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X2 [Helianthus annuus] gb|OTF98781.1| putative phosphoglycerate mutase-like family protein [Helianthus annuus] Length = 1049 Score = 76.6 bits (187), Expect = 9e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISN 249 AEDFPPP+IPQGFSGYF+SAGVLERLVNLWPF+KH N Sbjct: 1008 AEDFPPPSIPQGFSGYFKSAGVLERLVNLWPFHKHANGN 1046 >ref|XP_022005465.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X1 [Helianthus annuus] ref|XP_022005466.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X1 [Helianthus annuus] ref|XP_022005467.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X1 [Helianthus annuus] ref|XP_022005468.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X1 [Helianthus annuus] Length = 1055 Score = 76.6 bits (187), Expect = 9e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISN 249 AEDFPPP+IPQGFSGYF+SAGVLERLVNLWPF+KH N Sbjct: 1014 AEDFPPPSIPQGFSGYFKSAGVLERLVNLWPFHKHANGN 1052 >ref|XP_023772927.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP1-like [Lactuca sativa] Length = 1057 Score = 76.3 bits (186), Expect = 1e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISN 249 AEDFPPPT PQGFSGYF+SAGVLERLVNLWPF+KH N Sbjct: 1016 AEDFPPPTTPQGFSGYFKSAGVLERLVNLWPFHKHANGN 1054 >ref|XP_020551973.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X4 [Sesamum indicum] ref|XP_020551974.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X4 [Sesamum indicum] Length = 975 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPP+IPQGFSGYF +SA VLERLVNLWPFNKHG +N K Sbjct: 934 AEDFPPPSIPQGFSGYFSKSAAVLERLVNLWPFNKHGNTNGK 975 >ref|XP_020551972.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X3 [Sesamum indicum] Length = 1013 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPP+IPQGFSGYF +SA VLERLVNLWPFNKHG +N K Sbjct: 972 AEDFPPPSIPQGFSGYFSKSAAVLERLVNLWPFNKHGNTNGK 1013 >ref|XP_011085883.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Sesamum indicum] Length = 1052 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPP+IPQGFSGYF +SA VLERLVNLWPFNKHG +N K Sbjct: 1011 AEDFPPPSIPQGFSGYFSKSAAVLERLVNLWPFNKHGNTNGK 1052 >ref|XP_011085882.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Sesamum indicum] Length = 1058 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPP+IPQGFSGYF +SA VLERLVNLWPFNKHG +N K Sbjct: 1017 AEDFPPPSIPQGFSGYFSKSAAVLERLVNLWPFNKHGNTNGK 1058 >gb|KVI09074.1| Histidine phosphatase superfamily, clade-2 [Cynara cardunculus var. scolymus] Length = 1151 Score = 75.1 bits (183), Expect = 3e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKH 261 AEDFPPPT PQGFSGYF+SAGVLERLVNLWPF+KH Sbjct: 1085 AEDFPPPTTPQGFSGYFKSAGVLERLVNLWPFHKH 1119 >gb|OWM69782.1| hypothetical protein CDL15_Pgr025631 [Punica granatum] Length = 1062 Score = 73.2 bits (178), Expect = 1e-12 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISN 249 AEDFPPP+ PQGFSGYF +SA VLERLVNLWPFNKHG +N Sbjct: 1004 AEDFPPPSTPQGFSGYFSKSAAVLERLVNLWPFNKHGYAN 1043 >gb|OWM69775.1| hypothetical protein CDL15_Pgr025624 [Punica granatum] Length = 315 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISN 249 AEDFPPP+ PQGFSGYF +SA VLERLVNLWPFNKHG +N Sbjct: 272 AEDFPPPSTPQGFSGYFSKSATVLERLVNLWPFNKHGYAN 311 >ref|XP_011098565.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 isoform X2 [Sesamum indicum] Length = 1052 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISN 249 AEDFPPPTIPQGFSGYF +SA VLERLVNLWPFNKH +N Sbjct: 1011 AEDFPPPTIPQGFSGYFSKSAAVLERLVNLWPFNKHRNTN 1050 >ref|XP_011098563.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 isoform X1 [Sesamum indicum] Length = 1058 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISN 249 AEDFPPPTIPQGFSGYF +SA VLERLVNLWPFNKH +N Sbjct: 1017 AEDFPPPTIPQGFSGYFSKSAAVLERLVNLWPFNKHRNTN 1056 >gb|PKI37224.1| hypothetical protein CRG98_042376 [Punica granatum] Length = 737 Score = 72.4 bits (176), Expect = 3e-12 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISN 249 AEDFPPP+ PQGFSGYF +SA VLERLVNLWPFNKHG +N Sbjct: 694 AEDFPPPSTPQGFSGYFSKSATVLERLVNLWPFNKHGYAN 733 >gb|PKI46533.1| hypothetical protein CRG98_033090 [Punica granatum] Length = 162 Score = 69.3 bits (168), Expect = 3e-12 Identities = 31/37 (83%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHG 258 AEDFPPP++PQGFSGYF +SA VLERLVNLWPFNK G Sbjct: 120 AEDFPPPSVPQGFSGYFSKSAAVLERLVNLWPFNKQG 156 >emb|CDP02189.1| unnamed protein product [Coffea canephora] Length = 1048 Score = 71.6 bits (174), Expect = 5e-12 Identities = 33/42 (78%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYF-RSAGVLERLVNLWPFNKHGISNVK 243 AEDFPPP+ PQGFSGYF +SA VLERL NLWPFNKHG +N K Sbjct: 1007 AEDFPPPSTPQGFSGYFSKSAAVLERLANLWPFNKHGNTNGK 1048 >ref|XP_022026441.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X2 [Helianthus annuus] ref|XP_022026442.1| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2-like isoform X2 [Helianthus annuus] gb|OTG35408.1| putative phosphoglycerate mutase-like family protein [Helianthus annuus] Length = 1050 Score = 71.6 bits (174), Expect = 5e-12 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 365 AEDFPPPTIPQGFSGYFRSAGVLERLVNLWPFNKHGISNV 246 AEDFPPP+ PQGFSGYF+SAG+LERL NLWPF+KH +V Sbjct: 1010 AEDFPPPSTPQGFSGYFKSAGMLERLANLWPFHKHANKHV 1049