BLASTX nr result
ID: Chrysanthemum22_contig00046385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046385 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG13612.1| putative leucine-rich repeat domain, L domain-lik... 59 3e-07 ref|XP_021979169.1| disease resistance protein RPP5-like [Helian... 59 3e-07 gb|OTG13608.1| putative leucine-rich repeat domain, L domain-lik... 58 4e-07 gb|KVH87669.1| hypothetical protein Ccrd_025047 [Cynara carduncu... 58 4e-07 ref|XP_021978699.1| disease resistance protein TAO1-like [Helian... 58 7e-07 gb|OTG13396.1| putative leucine-rich repeat domain, L domain-lik... 57 8e-07 gb|OTG13642.1| putative leucine-rich repeat domain, L domain-lik... 57 1e-06 gb|OTG13677.1| putative leucine-rich repeat domain, L domain-lik... 57 1e-06 ref|XP_021979213.1| disease resistance protein TAO1-like [Helian... 57 1e-06 ref|XP_021978675.1| disease resistance protein LAZ5-like [Helian... 57 1e-06 ref|XP_023762169.1| TMV resistance protein N-like [Lactuca sativa] 57 1e-06 gb|OTG13613.1| putative leucine-rich repeat domain, L domain-lik... 57 1e-06 gb|PLY86772.1| hypothetical protein LSAT_4X148261 [Lactuca sativa] 57 1e-06 ref|XP_023767542.1| TMV resistance protein N-like [Lactuca sativ... 57 2e-06 gb|OTG13633.1| putative leucine-rich repeat domain, L domain-lik... 55 6e-06 gb|OTG13636.1| putative leucine-rich repeat domain, L domain-lik... 55 6e-06 ref|XP_021979186.1| disease resistance protein TAO1-like [Helian... 55 6e-06 ref|XP_021979188.1| TMV resistance protein N-like [Helianthus an... 55 6e-06 ref|XP_021979162.1| disease resistance protein TAO1-like [Helian... 55 8e-06 gb|OTG13604.1| putative disease resistance protein (TIR-NBS-LRR ... 55 9e-06 >gb|OTG13612.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 573 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQTFIFRVVFFV 164 +L+DIP S+ MKSLK L+LSDC +++ LPEELGCLE LE L R + ++ Sbjct: 391 SLQDIPNSICKMKSLKCLDLSDCHQLQKLPEELGCLECLEELDLTGCRSLLYI 443 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP S+ +K LK LNLSDC V+ EELGCLE LENL Sbjct: 343 SLRDIPNSICKLKRLKCLNLSDCHPVQKFLEELGCLECLENL 384 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQ 134 +L+DIP S+S MKSL +LNLS C V+ LPEELG LE L+ L+ Sbjct: 487 SLKDIPSSISKMKSLTHLNLSHCIRVDKLPEELGSLECLKELR 529 >ref|XP_021979169.1| disease resistance protein RPP5-like [Helianthus annuus] Length = 1166 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQTFIFRVVFFV 164 +L+DIP S+ MKSLK L+LSDC +++ LPEELGCLE LE L R + ++ Sbjct: 984 SLQDIPNSICKMKSLKCLDLSDCHQLQKLPEELGCLECLEELDLTGCRSLLYI 1036 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP S+ +K LK LNLSDC V+ EELGCLE LENL Sbjct: 936 SLRDIPNSICKLKRLKCLNLSDCHPVQKFLEELGCLECLENL 977 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQ 134 +L+DIP S+S MKSL +LNLS C V+ LPEELG LE L+ L+ Sbjct: 1080 SLKDIPSSISKMKSLTHLNLSHCIRVDKLPEELGSLECLKELR 1122 >gb|OTG13608.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 250 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 IALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLE 125 I+LRDIP S+ MK LK L+LS C ++E LPEELGCLE LE Sbjct: 111 ISLRDIPNSIGRMKCLKRLHLSSCHQIEKLPEELGCLERLE 151 >gb|KVH87669.1| hypothetical protein Ccrd_025047 [Cynara cardunculus var. scolymus] Length = 256 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 3 IALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 + LRDIP ++ +KSLKYL+L D VE LPEELGCLE LE L Sbjct: 38 LVLRDIPNNICRLKSLKYLSLHDSIRVEKLPEELGCLECLEKL 80 >ref|XP_021978699.1| disease resistance protein TAO1-like [Helianthus annuus] Length = 467 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 IALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLE 125 I+LRDIP S+ MK LK L+LS C ++E LPEELGCLE LE Sbjct: 328 ISLRDIPNSIGRMKCLKRLHLSSCHQIEKLPEELGCLERLE 368 >gb|OTG13396.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 254 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP S+ MK LKYL+L C +VETLPE GCLE LE L Sbjct: 107 SLRDIPNSICKMKCLKYLSLCGCEKVETLPENFGCLECLEKL 148 >gb|OTG13642.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 250 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 3 IALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLE 125 ++LRDIP S+ MK LK L++S C ++E LPEELGCLE LE Sbjct: 111 VSLRDIPNSIGRMKCLKRLHISSCHQIEKLPEELGCLERLE 151 >gb|OTG13677.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 370 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +L+DIP S+ MKSLK L+LSDC +V LPEELGCL LE L Sbjct: 240 SLQDIPNSIGKMKSLKRLDLSDCHQVRKLPEELGCLPCLEEL 281 >ref|XP_021979213.1| disease resistance protein TAO1-like [Helianthus annuus] Length = 442 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +L+DIP S+ MKSLK L+LSDC +V LPEELGCL LE L Sbjct: 240 SLQDIPNSIGKMKSLKRLDLSDCHQVRKLPEELGCLPCLEEL 281 >ref|XP_021978675.1| disease resistance protein LAZ5-like [Helianthus annuus] Length = 581 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP S+ MK LKYL+L C +VETLPE GCLE LE L Sbjct: 434 SLRDIPNSICKMKCLKYLSLCGCEKVETLPENFGCLECLEKL 475 >ref|XP_023762169.1| TMV resistance protein N-like [Lactuca sativa] Length = 967 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 9 LRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 L+DIP S+ MK LKYLNL C VE LPEELGCLE L+ L Sbjct: 855 LQDIPNSICEMKCLKYLNLYKCIRVEKLPEELGCLECLKEL 895 >gb|OTG13613.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 250 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 3 IALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLE 125 I+LRDIP S+ MK LK L++S C +E LPEELGCLE LE Sbjct: 111 ISLRDIPNSIGRMKCLKRLHISSCHRIEKLPEELGCLERLE 151 >gb|PLY86772.1| hypothetical protein LSAT_4X148261 [Lactuca sativa] Length = 1130 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 9 LRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 L+DIP S+ MK LKYLNL C VE LPEELGCLE L+ L Sbjct: 1018 LQDIPNSICEMKCLKYLNLYKCIRVEKLPEELGCLECLKEL 1058 >ref|XP_023767542.1| TMV resistance protein N-like [Lactuca sativa] ref|XP_023767543.1| TMV resistance protein N-like [Lactuca sativa] gb|PLY82649.1| hypothetical protein LSAT_5X38001 [Lactuca sativa] Length = 1196 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 9 LRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 LRDIPES+ MK LKYL+L C ++E LPEELGCLE LE L Sbjct: 1096 LRDIPESICMMKCLKYLSLYYCIKLEKLPEELGCLECLEIL 1136 >gb|OTG13633.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 424 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +L+DIP S+ MKSLK L LS+C +V LPEELGCL+ LE L Sbjct: 205 SLQDIPNSIGKMKSLKRLYLSNCHQVRKLPEELGCLQCLEEL 246 >gb|OTG13636.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 431 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQ 134 +LRDIP S+ MK LKYL + C +VE LPE+LGCL++LE L+ Sbjct: 288 SLRDIPNSICKMKWLKYLRVVGCDKVEKLPEKLGCLKYLEKLE 330 >ref|XP_021979186.1| disease resistance protein TAO1-like [Helianthus annuus] Length = 433 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +L+DIP S+ MKSLK L LS+C +V LPEELGCL+ LE L Sbjct: 182 SLQDIPNSIGKMKSLKRLYLSNCHQVRKLPEELGCLQCLEEL 223 >ref|XP_021979188.1| TMV resistance protein N-like [Helianthus annuus] Length = 905 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENLQ 134 +LRDIP S+ MK LKYL + C +VE LPE+LGCL++LE L+ Sbjct: 762 SLRDIPNSICKMKWLKYLRVVGCDKVEKLPEKLGCLKYLEKLE 804 >ref|XP_021979162.1| disease resistance protein TAO1-like [Helianthus annuus] Length = 473 Score = 55.1 bits (131), Expect = 8e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP+S+ MK LK L LS C +VE LPEELGCLE L+ L Sbjct: 380 SLRDIPKSICKMKCLKRLRLSYCEQVERLPEELGCLECLKEL 421 >gb|OTG13604.1| putative disease resistance protein (TIR-NBS-LRR class) family [Helianthus annuus] Length = 1162 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 6 ALRDIPESVSNMKSLKYLNLSDCFEVETLPEELGCLEFLENL 131 +LRDIP+S+ MK LK L LS C +VE LPEELGCLE L+ L Sbjct: 1069 SLRDIPKSICKMKCLKRLRLSYCEQVERLPEELGCLECLKEL 1110