BLASTX nr result
ID: Chrysanthemum22_contig00046373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00046373 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91599.1| hypothetical protein Ccrd_006376 [Cynara carduncu... 112 3e-25 >gb|KVH91599.1| hypothetical protein Ccrd_006376 [Cynara cardunculus var. scolymus] Length = 2423 Score = 112 bits (279), Expect = 3e-25 Identities = 71/135 (52%), Positives = 77/135 (57%), Gaps = 9/135 (6%) Frame = -3 Query: 380 PGSSVLIERAQVNLGDVEEDSKTENTSSATEQISECDGFPXXXXXXXXXXXXXXXXNPS- 204 P SS+L ERAQVN GD EED+K E TSSATEQ SE DG P Sbjct: 26 PLSSILDERAQVNSGDGEEDTKMEYTSSATEQTSEPDGIPAVASVDDNSGDTNTDVYSDS 85 Query: 203 --------GPPSSDLEPTFQPKEDLVVDFHGDEGIKLPPTSDDSGDVSLPSDVISGREVT 48 G PSSD PT PKED+V F GD GI LP TS DS VSL V+SG EVT Sbjct: 86 QRFLPISDGVPSSDPAPTI-PKEDVVAGFDGDGGITLPSTSGDSEYVSLTDSVLSGGEVT 144 Query: 47 PVSLSELAKAFQLLG 3 P L++LAK FQLLG Sbjct: 145 PAGLTQLAKVFQLLG 159