BLASTX nr result
ID: Chrysanthemum22_contig00045737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00045737 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023755504.1| probable sodium/metabolite cotransporter BAS... 56 6e-06 >ref|XP_023755504.1| probable sodium/metabolite cotransporter BASS3, chloroplastic [Lactuca sativa] gb|PLY91730.1| hypothetical protein LSAT_9X16381 [Lactuca sativa] Length = 428 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 144 CFTSYPFI-EVDLHRREGNFNILSHGKSPNDGSNVAVKCDL 263 C TSYPFI +V LHRREGNF +LS+G +PN GS +AVK D+ Sbjct: 68 CSTSYPFIGKVGLHRREGNFILLSYGTNPNTGSVMAVKADI 108