BLASTX nr result
ID: Chrysanthemum22_contig00045691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00045691 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022012596.1| plant intracellular Ras-group-related LRR pr... 57 2e-06 >ref|XP_022012596.1| plant intracellular Ras-group-related LRR protein 9-like [Helianthus annuus] gb|OTG33534.1| putative plant intracellular ras group-related LRR 1 [Helianthus annuus] Length = 500 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 10/60 (16%) Frame = -3 Query: 496 VEAVTVCLSRRWLDLLVDEEEKSRSVDNETQSGGWLT----------DAVGR*LGGGERT 347 VEAV + +++RWLDLL++EEEKS+ V+NE GGWLT +VG LGGG T Sbjct: 430 VEAVKMFMAKRWLDLLLEEEEKSKRVENEPAQGGWLTRSTSWLSNVAGSVGGYLGGGGST 489