BLASTX nr result
ID: Chrysanthemum22_contig00045622
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00045622 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT35537.1| hypothetical protein POPTR_005G080700v3 [Populus ... 65 3e-10 ref|XP_022029755.1| 60S ribosomal protein L30 [Helianthus annuus... 63 1e-09 ref|XP_022013611.1| 60S ribosomal protein L30 [Helianthus annuus... 63 1e-09 ref|XP_011005642.1| PREDICTED: 60S ribosomal protein L30-like [P... 63 1e-09 ref|XP_007225897.1| 60S ribosomal protein L30 [Prunus persica] >... 63 1e-09 ref|XP_002309997.1| hypothetical protein POPTR_0007s06050g [Popu... 63 1e-09 gb|PNT35539.1| hypothetical protein POPTR_005G080700v3 [Populus ... 63 2e-09 ref|XP_019579016.1| PREDICTED: putative 60S ribosomal protein L3... 63 2e-09 ref|XP_002306331.1| hypothetical protein POPTR_0005s08250g [Popu... 63 2e-09 gb|PLY96266.1| hypothetical protein LSAT_6X95701 [Lactuca sativa] 63 2e-09 gb|KFK39216.1| hypothetical protein AALP_AA3G214300 [Arabis alpina] 61 2e-09 gb|KVI07594.1| Ribosomal protein L30e, partial [Cynara carduncul... 63 2e-09 ref|XP_020541088.1| 60S ribosomal protein L30-2, partial [Jatrop... 61 2e-09 gb|EXC06688.1| Putative 60S ribosomal protein L30-1 [Morus notab... 61 3e-09 gb|OTG03066.1| putative ribosomal protein L30e [Helianthus annuus] 63 3e-09 ref|XP_023876380.1| 60S ribosomal protein L30-2-like, partial [Q... 61 3e-09 gb|POE81255.1| 60s ribosomal protein l30-2 [Quercus suber] 61 3e-09 ref|XP_009345526.1| PREDICTED: 60S ribosomal protein L30-like [P... 62 5e-09 ref|XP_008339510.1| PREDICTED: 60S ribosomal protein L30 [Malus ... 62 5e-09 ref|XP_008338184.1| PREDICTED: 60S ribosomal protein L30-like [M... 62 5e-09 >gb|PNT35537.1| hypothetical protein POPTR_005G080700v3 [Populus trichocarpa] Length = 111 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 DNVDLGTACGKYFRVSCLSI+DAGDSDIIK Sbjct: 76 DNVDLGTACGKYFRVSCLSIVDAGDSDIIK 105 >ref|XP_022029755.1| 60S ribosomal protein L30 [Helianthus annuus] ref|XP_022029756.1| 60S ribosomal protein L30 [Helianthus annuus] ref|XP_022002451.1| 60S ribosomal protein L30 [Helianthus annuus] ref|XP_023747400.1| 60S ribosomal protein L30-like [Lactuca sativa] gb|OTG32678.1| putative 60S ribosomal protein L30 [Helianthus annuus] Length = 112 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_022013611.1| 60S ribosomal protein L30 [Helianthus annuus] ref|XP_022016497.1| 60S ribosomal protein L30 [Helianthus annuus] ref|XP_023769202.1| 60S ribosomal protein L30 [Lactuca sativa] gb|OTF90449.1| putative ribosomal protein L30e [Helianthus annuus] gb|OTF96700.1| putative ribosomal protein L30e [Helianthus annuus] gb|PLY99686.1| hypothetical protein LSAT_0X9581 [Lactuca sativa] Length = 112 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_011005642.1| PREDICTED: 60S ribosomal protein L30-like [Populus euphratica] Length = 112 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_007225897.1| 60S ribosomal protein L30 [Prunus persica] ref|XP_008233983.1| PREDICTED: 60S ribosomal protein L30 [Prunus mume] ref|XP_021810009.1| 60S ribosomal protein L30-like [Prunus avium] gb|ONI35025.1| hypothetical protein PRUPE_1G511000 [Prunus persica] Length = 112 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_002309997.1| hypothetical protein POPTR_0007s06050g [Populus trichocarpa] ref|XP_006380449.1| hypothetical protein POPTR_0007s06050g [Populus trichocarpa] gb|ABK92689.1| unknown [Populus trichocarpa] gb|ABK93438.1| unknown [Populus trichocarpa] gb|PNT27839.1| hypothetical protein POPTR_007G086800v3 [Populus trichocarpa] gb|PNT27840.1| hypothetical protein POPTR_007G086800v3 [Populus trichocarpa] Length = 112 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 106 >gb|PNT35539.1| hypothetical protein POPTR_005G080700v3 [Populus trichocarpa] Length = 111 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSI+DAGDSDIIK Sbjct: 76 NNVDLGTACGKYFRVSCLSIVDAGDSDIIK 105 >ref|XP_019579016.1| PREDICTED: putative 60S ribosomal protein L30-1 [Rhinolophus sinicus] Length = 112 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSI+DAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDAGDSDIIK 106 >ref|XP_002306331.1| hypothetical protein POPTR_0005s08250g [Populus trichocarpa] ref|XP_011021883.1| PREDICTED: 60S ribosomal protein L30-like [Populus euphratica] ref|XP_011039563.1| PREDICTED: 60S ribosomal protein L30-like [Populus euphratica] gb|ABK93914.1| unknown [Populus trichocarpa] gb|ABK94539.1| unknown [Populus trichocarpa] gb|PNT35536.1| hypothetical protein POPTR_005G080700v3 [Populus trichocarpa] gb|PNT35538.1| hypothetical protein POPTR_005G080700v3 [Populus trichocarpa] gb|PNT35540.1| hypothetical protein POPTR_005G080700v3 [Populus trichocarpa] Length = 112 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSI+DAGDSDIIK Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDAGDSDIIK 106 >gb|PLY96266.1| hypothetical protein LSAT_6X95701 [Lactuca sativa] Length = 131 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 96 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 125 >gb|KFK39216.1| hypothetical protein AALP_AA3G214300 [Arabis alpina] Length = 48 Score = 60.8 bits (146), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSI+D GDSDIIK Sbjct: 13 NNVDLGTACGKYFRVSCLSIVDPGDSDIIK 42 >gb|KVI07594.1| Ribosomal protein L30e, partial [Cynara cardunculus var. scolymus] Length = 143 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 108 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 137 >ref|XP_020541088.1| 60S ribosomal protein L30-2, partial [Jatropha curcas] Length = 73 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIID GDSDIIK Sbjct: 38 NNVDLGTACGKYFRVSCLSIIDPGDSDIIK 67 >gb|EXC06688.1| Putative 60S ribosomal protein L30-1 [Morus notabilis] Length = 74 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 DNVDLGTACGKY+RVSCLSI+D GDSDIIK Sbjct: 39 DNVDLGTACGKYYRVSCLSILDPGDSDIIK 68 >gb|OTG03066.1| putative ribosomal protein L30e [Helianthus annuus] Length = 148 Score = 63.2 bits (152), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 113 NNVDLGTACGKYFRVSCLSIIDAGDSDIIK 142 >ref|XP_023876380.1| 60S ribosomal protein L30-2-like, partial [Quercus suber] Length = 81 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIID GDSDIIK Sbjct: 46 NNVDLGTACGKYFRVSCLSIIDPGDSDIIK 75 >gb|POE81255.1| 60s ribosomal protein l30-2 [Quercus suber] Length = 82 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NVDLGTACGKYFRVSCLSIID GDSDIIK Sbjct: 47 NNVDLGTACGKYFRVSCLSIIDPGDSDIIK 76 >ref|XP_009345526.1| PREDICTED: 60S ribosomal protein L30-like [Pyrus x bretschneideri] ref|XP_009347208.1| PREDICTED: 60S ribosomal protein L30-like [Pyrus x bretschneideri] Length = 112 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NV+LGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVELGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_008339510.1| PREDICTED: 60S ribosomal protein L30 [Malus domestica] ref|XP_008352901.1| PREDICTED: 60S ribosomal protein L30 [Malus domestica] ref|XP_009345832.1| PREDICTED: 60S ribosomal protein L30 [Pyrus x bretschneideri] ref|XP_009345847.1| PREDICTED: 60S ribosomal protein L30 [Pyrus x bretschneideri] Length = 112 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NV+LGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVELGTACGKYFRVSCLSIIDAGDSDIIK 106 >ref|XP_008338184.1| PREDICTED: 60S ribosomal protein L30-like [Malus domestica] Length = 112 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 466 DNVDLGTACGKYFRVSCLSIIDAGDSDIIK 555 +NV+LGTACGKYFRVSCLSIIDAGDSDIIK Sbjct: 77 NNVELGTACGKYFRVSCLSIIDAGDSDIIK 106