BLASTX nr result
ID: Chrysanthemum22_contig00045305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00045305 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI07164.1| Pentatricopeptide repeat-containing protein [Cyna... 57 4e-07 >gb|KVI07164.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 512 Score = 57.4 bits (137), Expect = 4e-07 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 14/73 (19%) Frame = +3 Query: 144 MFSITQICHKITHTVTFFY---RPLCSNTNHFTSGFRRIEKYLV------NPNFSLNDD- 293 MFSI QI HK+ ++ + R LCSN N F+ GFRRIEKYL N NF LN++ Sbjct: 1 MFSIAQIGHKVVQGISCYCGISRSLCSNGNGFSDGFRRIEKYLTGCQKSSNGNFVLNENH 60 Query: 294 ----NSASTSGRY 320 +S TSGRY Sbjct: 61 EESIDSVGTSGRY 73