BLASTX nr result
ID: Chrysanthemum22_contig00045094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00045094 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772695.1| multiple organellar RNA editing factor 7, mi... 59 2e-07 ref|XP_022013619.1| multiple organellar RNA editing factor 7, mi... 57 5e-07 >ref|XP_023772695.1| multiple organellar RNA editing factor 7, mitochondrial isoform X1 [Lactuca sativa] gb|PLY78622.1| hypothetical protein LSAT_4X94060 [Lactuca sativa] Length = 196 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = +3 Query: 333 GEPLIDGCVVPYDEMFHEDWLQDQSGNGIXXXXXXXXXXKEQK 461 GEP IDG VVPYDEMFHEDW++D+S NG KEQK Sbjct: 150 GEPFIDGHVVPYDEMFHEDWVKDESNNGFRRRSGRRSRRKEQK 192 >ref|XP_022013619.1| multiple organellar RNA editing factor 7, mitochondrial [Helianthus annuus] ref|XP_022013620.1| multiple organellar RNA editing factor 7, mitochondrial [Helianthus annuus] gb|OTF96707.1| hypothetical protein HannXRQ_Chr15g0497121 [Helianthus annuus] Length = 180 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +3 Query: 333 GEPLIDGCVVPYDEMFHEDWLQDQSGNG 416 GEP DGCVVPYDE FHEDWLQD+S NG Sbjct: 133 GEPFTDGCVVPYDETFHEDWLQDRSDNG 160