BLASTX nr result
ID: Chrysanthemum22_contig00044983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00044983 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONI06016.1| hypothetical protein PRUPE_5G034300 [Prunus persica] 58 3e-07 ref|XP_009401255.1| PREDICTED: uncharacterized protein LOC103985... 56 5e-06 ref|XP_003612886.1| PLATZ transcription factor family protein [M... 55 5e-06 gb|PNT44576.1| hypothetical protein POPTR_003G092800v3 [Populus ... 54 6e-06 gb|PKI46879.1| hypothetical protein CRG98_032690 [Punica granatum] 54 7e-06 gb|EMS51546.1| hypothetical protein TRIUR3_30366 [Triticum urartu] 55 8e-06 gb|KJB21098.1| hypothetical protein B456_003G183000 [Gossypium r... 54 8e-06 dbj|BAT75130.1| hypothetical protein VIGAN_01294400 [Vigna angul... 55 8e-06 ref|XP_009371219.1| PREDICTED: uncharacterized protein LOC103960... 55 1e-05 >gb|ONI06016.1| hypothetical protein PRUPE_5G034300 [Prunus persica] Length = 159 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKVNSFGHC*LICYEF 444 NTCEVCERSLLDSFRFCSLGCKVN+ LI + F Sbjct: 118 NTCEVCERSLLDSFRFCSLGCKVNNTMSQSLILFSF 153 >ref|XP_009401255.1| PREDICTED: uncharacterized protein LOC103985321 [Musa acuminata subsp. malaccensis] Length = 240 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKVNSFGH 468 NTCEVCERSLLDSFRFCSLGCK++ G+ Sbjct: 136 NTCEVCERSLLDSFRFCSLGCKISGTGN 163 >ref|XP_003612886.1| PLATZ transcription factor family protein [Medicago truncatula] gb|AES95844.1| PLATZ transcription factor family protein [Medicago truncatula] Length = 189 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKVNSFGHC*LICY 450 NTCEVCERSLLDSFRFCSLGCKV F L+C+ Sbjct: 139 NTCEVCERSLLDSFRFCSLGCKVIYFT---LLCF 169 >gb|PNT44576.1| hypothetical protein POPTR_003G092800v3 [Populus trichocarpa] Length = 140 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKV 483 NTCEVCERSLLDSFRFCSLGCKV Sbjct: 118 NTCEVCERSLLDSFRFCSLGCKV 140 >gb|PKI46879.1| hypothetical protein CRG98_032690 [Punica granatum] Length = 143 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKV 483 NTCEVCERSLLDSFRFCSLGCKV Sbjct: 118 NTCEVCERSLLDSFRFCSLGCKV 140 >gb|EMS51546.1| hypothetical protein TRIUR3_30366 [Triticum urartu] Length = 275 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 7/35 (20%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKV-------NSFGH 468 NTCEVCERSLLDSFRFCSLGCKV SFGH Sbjct: 137 NTCEVCERSLLDSFRFCSLGCKVCICPPYNPSFGH 171 >gb|KJB21098.1| hypothetical protein B456_003G183000 [Gossypium raimondii] Length = 174 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKVNSF 474 NTCEVC+RSL+D+FRFCSLGCKVN F Sbjct: 121 NTCEVCDRSLVDNFRFCSLGCKVNFF 146 >dbj|BAT75130.1| hypothetical protein VIGAN_01294400 [Vigna angularis var. angularis] Length = 234 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKVN 480 NTCEVCERSLLDS+RFCSLGCKVN Sbjct: 168 NTCEVCERSLLDSYRFCSLGCKVN 191 >ref|XP_009371219.1| PREDICTED: uncharacterized protein LOC103960461 [Pyrus x bretschneideri] Length = 221 Score = 54.7 bits (130), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -2 Query: 551 NTCEVCERSLLDSFRFCSLGCKV--NSFGH 468 NTCEVCERSLLDSFRFCSLGCK+ S GH Sbjct: 118 NTCEVCERSLLDSFRFCSLGCKIVGTSSGH 147