BLASTX nr result
ID: Chrysanthemum22_contig00044726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00044726 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022017475.1| pentatricopeptide repeat-containing protein ... 189 3e-53 gb|KVH88583.1| Pentatricopeptide repeat-containing protein [Cyna... 184 1e-51 ref|XP_023747997.1| pentatricopeptide repeat-containing protein ... 184 1e-51 ref|XP_023512954.1| pentatricopeptide repeat-containing protein ... 174 7e-48 ref|XP_022986985.1| pentatricopeptide repeat-containing protein ... 174 7e-48 ref|XP_022943463.1| pentatricopeptide repeat-containing protein ... 173 2e-47 ref|XP_020551276.1| pentatricopeptide repeat-containing protein ... 171 5e-47 ref|XP_009630538.1| PREDICTED: pentatricopeptide repeat-containi... 172 6e-47 emb|CBI37724.3| unnamed protein product, partial [Vitis vinifera] 166 6e-47 gb|OMP11367.1| hypothetical protein COLO4_03845 [Corchorus olito... 165 7e-47 ref|XP_017189209.1| PREDICTED: pentatricopeptide repeat-containi... 167 1e-46 ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containi... 171 1e-46 ref|XP_019257370.1| PREDICTED: pentatricopeptide repeat-containi... 171 1e-46 ref|XP_020551271.1| pentatricopeptide repeat-containing protein ... 171 1e-46 ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containi... 171 1e-46 gb|PIN20651.1| hypothetical protein CDL12_06661 [Handroanthus im... 171 2e-46 gb|PIN06643.1| hypothetical protein CDL12_20802 [Handroanthus im... 170 4e-46 gb|KZV34703.1| pentatricopeptide repeat-containing protein mitoc... 168 6e-46 ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containi... 169 7e-46 ref|XP_006384866.1| hypothetical protein POPTR_0004s21780g [Popu... 167 1e-45 >ref|XP_022017475.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Helianthus annuus] ref|XP_022017476.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Helianthus annuus] gb|OTF91826.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 644 Score = 189 bits (479), Expect = 3e-53 Identities = 86/94 (91%), Positives = 91/94 (96%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DT+FVL DVEGEQ+EDPLLYHSEKLAIVYGLM+LTKGKT+RIRKNLRICGDCHLF Sbjct: 551 VGYVPDTSFVLHDVEGEQMEDPLLYHSEKLAIVYGLMALTKGKTVRIRKNLRICGDCHLF 610 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLAQME RN+VIRDPIRYHHFQGGVCSCGDYW Sbjct: 611 AKLLAQMEGRNIVIRDPIRYHHFQGGVCSCGDYW 644 >gb|KVH88583.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 637 Score = 184 bits (468), Expect = 1e-51 Identities = 85/94 (90%), Positives = 91/94 (96%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV D+NFVLQDVEGEQ+EDPLLYHSEKLAIVYGLM+LTKGK IRIRKNLRICGDCHLF Sbjct: 544 VGYVPDSNFVLQDVEGEQMEDPLLYHSEKLAIVYGLMALTKGKNIRIRKNLRICGDCHLF 603 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLA+MENR+VVIRD IRYHHF+GGVCSCGDYW Sbjct: 604 AKLLAKMENRHVVIRDQIRYHHFEGGVCSCGDYW 637 >ref|XP_023747997.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Lactuca sativa] gb|PLY63002.1| hypothetical protein LSAT_8X121220 [Lactuca sativa] Length = 645 Score = 184 bits (468), Expect = 1e-51 Identities = 85/94 (90%), Positives = 90/94 (95%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DT+FVLQDVEGEQ+EDPLL HSEKLAIVYGLM L KGKTIRIRKN+RICGDCHLF Sbjct: 552 VGYVHDTSFVLQDVEGEQMEDPLLCHSEKLAIVYGLMVLVKGKTIRIRKNIRICGDCHLF 611 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLA+MENRN+VIRDPIRYHHFQGGVCSCGDYW Sbjct: 612 AKLLAKMENRNIVIRDPIRYHHFQGGVCSCGDYW 645 >ref|XP_023512954.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucurbita pepo subsp. pepo] Length = 628 Score = 174 bits (441), Expect = 7e-48 Identities = 81/94 (86%), Positives = 87/94 (92%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED L YHSEKLAIV+GLMSL K KTIRIRKNLRICGDCHLF Sbjct: 535 VGYVPDTNFVLQDLEGEQMEDSLQYHSEKLAIVFGLMSLPKEKTIRIRKNLRICGDCHLF 594 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+AQ+ENR +VIRDPIRYHHFQ GVCSCGDYW Sbjct: 595 AKLVAQLENRVIVIRDPIRYHHFQEGVCSCGDYW 628 >ref|XP_022986985.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucurbita maxima] Length = 628 Score = 174 bits (441), Expect = 7e-48 Identities = 81/94 (86%), Positives = 87/94 (92%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED L YHSEKLAIV+GLMSL K KTIRIRKNLRICGDCHLF Sbjct: 535 VGYVPDTNFVLQDLEGEQMEDSLQYHSEKLAIVFGLMSLPKEKTIRIRKNLRICGDCHLF 594 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+AQ+ENR +VIRDPIRYHHFQ GVCSCGDYW Sbjct: 595 AKLVAQLENRVIVIRDPIRYHHFQEGVCSCGDYW 628 >ref|XP_022943463.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucurbita moschata] Length = 628 Score = 173 bits (438), Expect = 2e-47 Identities = 80/94 (85%), Positives = 87/94 (92%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED L YHSEKLAIV+GLMSL K KTIRIRKNLRICGDCHLF Sbjct: 535 VGYVPDTNFVLQDLEGEQMEDSLQYHSEKLAIVFGLMSLPKEKTIRIRKNLRICGDCHLF 594 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+AQ+ENR +VIRDPIRYHHFQ G+CSCGDYW Sbjct: 595 AKLVAQLENRVIVIRDPIRYHHFQEGLCSCGDYW 628 >ref|XP_020551276.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X2 [Sesamum indicum] Length = 596 Score = 171 bits (434), Expect = 5e-47 Identities = 76/93 (81%), Positives = 87/93 (93%) Frame = -3 Query: 559 GYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLFA 380 GYV DTNFVLQD+EGEQ+E+ L YHSEKLAIV+G+M L +GKT+RIRKNLRICGDCH FA Sbjct: 504 GYVPDTNFVLQDLEGEQMENSLAYHSEKLAIVFGMMCLPEGKTVRIRKNLRICGDCHDFA 563 Query: 379 KLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KLLA+MENR++VIRDPIRYHHFQGG+CSCGDYW Sbjct: 564 KLLAKMENRSIVIRDPIRYHHFQGGICSCGDYW 596 >ref|XP_009630538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] ref|XP_009630539.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] ref|XP_016494488.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016494497.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016494504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016494510.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016494514.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_018621821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] ref|XP_018621822.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] Length = 659 Score = 172 bits (436), Expect = 6e-47 Identities = 76/94 (80%), Positives = 88/94 (93%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED LLYHSEK+A+ +G+MSL++ KTIRIRKNLRICGDCHLF Sbjct: 566 VGYVPDTNFVLQDLEGEQMEDSLLYHSEKIAVAFGVMSLSREKTIRIRKNLRICGDCHLF 625 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLAQ+E R++VIRDPIRYHHFQ G+CSCGDYW Sbjct: 626 AKLLAQIERRSIVIRDPIRYHHFQDGICSCGDYW 659 >emb|CBI37724.3| unnamed protein product, partial [Vitis vinifera] Length = 339 Score = 166 bits (419), Expect = 6e-47 Identities = 73/94 (77%), Positives = 88/94 (93%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ ED L YHSEKLAI++GLM+L++ KT+RIRKNLRICGDCH+F Sbjct: 246 VGYVPDTNFVLQDLEGEQKEDSLRYHSEKLAIMFGLMNLSREKTVRIRKNLRICGDCHVF 305 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AK++++ME+R++VIRDPIRYHHFQ GVCSCGDYW Sbjct: 306 AKVVSRMEHRSIVIRDPIRYHHFQDGVCSCGDYW 339 >gb|OMP11367.1| hypothetical protein COLO4_03845 [Corchorus olitorius] Length = 330 Score = 165 bits (418), Expect = 7e-47 Identities = 75/94 (79%), Positives = 83/94 (88%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 +GYV DTN+VLQD+EGEQ +D L YHSEKLAIV+GLMSL G IRIRKNLRICGDCH F Sbjct: 237 IGYVPDTNYVLQDLEGEQRDDSLRYHSEKLAIVFGLMSLPMGSAIRIRKNLRICGDCHTF 296 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+A+MENR +VIRDPIRYHHFQ GVCSCGDYW Sbjct: 297 AKLVAKMENRLIVIRDPIRYHHFQNGVCSCGDYW 330 >ref|XP_017189209.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Malus domestica] Length = 435 Score = 167 bits (424), Expect = 1e-46 Identities = 76/94 (80%), Positives = 87/94 (92%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGY+ DTNFVLQD+EGEQ E LL HSEKLAIV+GLMSL+KGKT+RIRKNLRICGDCH+F Sbjct: 342 VGYIPDTNFVLQDLEGEQREVSLLSHSEKLAIVFGLMSLSKGKTVRIRKNLRICGDCHVF 401 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+A++E R++VIRDPIRYHHFQ GVCSCGDYW Sbjct: 402 AKLVAKIEERSIVIRDPIRYHHFQDGVCSCGDYW 435 >ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis melo] Length = 624 Score = 171 bits (433), Expect = 1e-46 Identities = 78/94 (82%), Positives = 86/94 (91%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED L YHSEKLAIV+GLMSL KTI IRKNLRICGDCH+F Sbjct: 531 VGYVPDTNFVLQDLEGEQMEDSLQYHSEKLAIVFGLMSLPNQKTIHIRKNLRICGDCHIF 590 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL+AQ+ENR +VIRDPIRYHHF+GGVCSCGDYW Sbjct: 591 AKLVAQLENRVIVIRDPIRYHHFRGGVCSCGDYW 624 >ref|XP_019257370.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] ref|XP_019257371.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] ref|XP_019257372.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] gb|OIS96339.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 659 Score = 171 bits (434), Expect = 1e-46 Identities = 76/94 (80%), Positives = 88/94 (93%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED LLYHSEK+A+ +G+MSL++ KTIRIRKNLRICGDCHLF Sbjct: 566 VGYVPDTNFVLQDLEGEQMEDSLLYHSEKIAVSFGVMSLSREKTIRIRKNLRICGDCHLF 625 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLAQ+E R++VIRDPIRYHHFQ G+CSCGDYW Sbjct: 626 AKLLAQIERRSIVIRDPIRYHHFQDGICSCGDYW 659 >ref|XP_020551271.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Sesamum indicum] ref|XP_020551272.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Sesamum indicum] ref|XP_020551273.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Sesamum indicum] ref|XP_020551274.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Sesamum indicum] ref|XP_020551275.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Sesamum indicum] Length = 661 Score = 171 bits (434), Expect = 1e-46 Identities = 76/93 (81%), Positives = 87/93 (93%) Frame = -3 Query: 559 GYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLFA 380 GYV DTNFVLQD+EGEQ+E+ L YHSEKLAIV+G+M L +GKT+RIRKNLRICGDCH FA Sbjct: 569 GYVPDTNFVLQDLEGEQMENSLAYHSEKLAIVFGMMCLPEGKTVRIRKNLRICGDCHDFA 628 Query: 379 KLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KLLA+MENR++VIRDPIRYHHFQGG+CSCGDYW Sbjct: 629 KLLAKMENRSIVIRDPIRYHHFQGGICSCGDYW 661 >ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804753.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804755.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804757.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804758.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804759.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_016449016.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449017.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449018.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449020.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] Length = 659 Score = 171 bits (433), Expect = 1e-46 Identities = 75/94 (79%), Positives = 88/94 (93%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ+ED LLYHSEK+A+ +G++SL++ KTIRIRKNLRICGDCHLF Sbjct: 566 VGYVPDTNFVLQDLEGEQMEDSLLYHSEKIAVAFGVLSLSREKTIRIRKNLRICGDCHLF 625 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKLLAQ+E R++VIRDPIRYHHFQ G+CSCGDYW Sbjct: 626 AKLLAQIERRSIVIRDPIRYHHFQDGICSCGDYW 659 >gb|PIN20651.1| hypothetical protein CDL12_06661 [Handroanthus impetiginosus] Length = 656 Score = 171 bits (432), Expect = 2e-46 Identities = 77/93 (82%), Positives = 86/93 (92%) Frame = -3 Query: 559 GYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLFA 380 GYV DTNFVLQD+EGEQ+E L +HSEKLAIVYGLMSL KGKTIRIRKNLRICGDCH+FA Sbjct: 564 GYVPDTNFVLQDLEGEQMETSLAFHSEKLAIVYGLMSLPKGKTIRIRKNLRICGDCHVFA 623 Query: 379 KLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KLLA++ENR++VIRDPIRYHHF+ G CSCGDYW Sbjct: 624 KLLAKVENRSIVIRDPIRYHHFEDGACSCGDYW 656 >gb|PIN06643.1| hypothetical protein CDL12_20802 [Handroanthus impetiginosus] Length = 656 Score = 170 bits (430), Expect = 4e-46 Identities = 76/93 (81%), Positives = 86/93 (92%) Frame = -3 Query: 559 GYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLFA 380 GYV DTNFVLQD+EGEQ+E L +HSEKLAIVYGLMSL KGKTIRIRKNLRICGDCH+F+ Sbjct: 564 GYVPDTNFVLQDLEGEQMETSLAFHSEKLAIVYGLMSLPKGKTIRIRKNLRICGDCHVFS 623 Query: 379 KLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KLLA++ENR++VIRDPIRYHHF+ G CSCGDYW Sbjct: 624 KLLAKLENRSIVIRDPIRYHHFEDGACSCGDYW 656 >gb|KZV34703.1| pentatricopeptide repeat-containing protein mitochondrial [Dorcoceras hygrometricum] Length = 585 Score = 168 bits (426), Expect = 6e-46 Identities = 75/93 (80%), Positives = 84/93 (90%) Frame = -3 Query: 559 GYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLFA 380 GYV DTNFVLQDVEGEQ+E LLYHSEKLAI +G+MS KGKTIRIRKNLRICGDCH+FA Sbjct: 493 GYVPDTNFVLQDVEGEQMETSLLYHSEKLAITFGIMSFPKGKTIRIRKNLRICGDCHVFA 552 Query: 379 KLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KL+ +MEN+++VIRDPIRYHHFQ G CSCGDYW Sbjct: 553 KLVTKMENQSIVIRDPIRYHHFQDGACSCGDYW 585 >ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis sativus] gb|KGN46644.1| hypothetical protein Csa_6G117760 [Cucumis sativus] Length = 624 Score = 169 bits (427), Expect = 7e-46 Identities = 76/94 (80%), Positives = 86/94 (91%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 +GYV DTNFVLQD+EGEQ+ED L YHSEKLAIV+GLMSL KTI IRKNLRICGDCH+F Sbjct: 531 LGYVPDTNFVLQDLEGEQMEDSLQYHSEKLAIVFGLMSLPNQKTIHIRKNLRICGDCHIF 590 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 AKL++Q+ENR +VIRDPIRYHHF+GGVCSCGDYW Sbjct: 591 AKLVSQLENRVIVIRDPIRYHHFRGGVCSCGDYW 624 >ref|XP_006384866.1| hypothetical protein POPTR_0004s21780g [Populus trichocarpa] Length = 571 Score = 167 bits (424), Expect = 1e-45 Identities = 75/94 (79%), Positives = 86/94 (91%) Frame = -3 Query: 562 VGYVSDTNFVLQDVEGEQLEDPLLYHSEKLAIVYGLMSLTKGKTIRIRKNLRICGDCHLF 383 VGYV DTNFVLQD+EGEQ++D L YHSEKLAIV+GLMSL +G+TIRIRKNLRICGDCHLF Sbjct: 478 VGYVPDTNFVLQDLEGEQMQDSLRYHSEKLAIVFGLMSLPRGQTIRIRKNLRICGDCHLF 537 Query: 382 AKLLAQMENRNVVIRDPIRYHHFQGGVCSCGDYW 281 KLLA+ME R +VIRDP+RYHHFQ G+CSCGD+W Sbjct: 538 TKLLAKMEQRIIVIRDPVRYHHFQDGLCSCGDFW 571