BLASTX nr result
ID: Chrysanthemum22_contig00044435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00044435 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG29005.1| putative leucine-rich repeat domain, L domain-lik... 68 9e-11 ref|XP_022035394.1| TMV resistance protein N-like [Helianthus an... 65 1e-09 gb|OTG25641.1| putative leucine-rich repeat domain, L domain-lik... 56 2e-06 ref|XP_022041045.1| TMV resistance protein N-like [Helianthus an... 56 2e-06 >gb|OTG29005.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 332 Score = 67.8 bits (164), Expect = 9e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -1 Query: 372 LHESVLLHKSLQYMNLMGCTHLQCLGRSKFEMEALVTLLL 253 LHESVL HK LQY+NL GCTHLQ LGRS EMEALVTLLL Sbjct: 113 LHESVLSHKRLQYINLSGCTHLQSLGRSNMEMEALVTLLL 152 >ref|XP_022035394.1| TMV resistance protein N-like [Helianthus annuus] Length = 707 Score = 64.7 bits (156), Expect = 1e-09 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 372 LHESVLLHKSLQYMNLMGCTHLQCLGRSKFEMEALVTLLLQ-CHHGIHVHKKSHR 211 LH+SVL HK ++Y+NL GCTHLQ LGRS EMEALVTLLL C + ++ + H+ Sbjct: 448 LHKSVLFHKRIRYLNLSGCTHLQGLGRSNMEMEALVTLLLSGCSNLEYIPEFGHK 502 >gb|OTG25641.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 318 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -1 Query: 372 LHESVLLHKSLQYMNLMGCTHLQCLGRSKFEMEALVTLLL 253 LHESVLLHK L+Y+NL CT L+ LGRS EMEAL LLL Sbjct: 35 LHESVLLHKRLRYLNLKRCTCLESLGRSHMEMEALEALLL 74 >ref|XP_022041045.1| TMV resistance protein N-like [Helianthus annuus] Length = 1433 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -1 Query: 372 LHESVLLHKSLQYMNLMGCTHLQCLGRSKFEMEALVTLLL 253 LHESVLLHK L+Y+NL CT L+ LGRS EMEAL LLL Sbjct: 669 LHESVLLHKRLRYLNLKRCTCLESLGRSHMEMEALEALLL 708