BLASTX nr result
ID: Chrysanthemum22_contig00044305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00044305 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022029909.1| putative pentatricopeptide repeat-containing... 73 3e-14 gb|OTG23304.1| putative tetratricopeptide-like helical domain-co... 73 3e-14 gb|OTG23302.1| putative tetratricopeptide-like helical domain-co... 71 3e-14 gb|OTG32860.1| putative tetratricopeptide repeat (TPR)-like supe... 72 5e-14 ref|XP_022031630.1| putative pentatricopeptide repeat-containing... 72 5e-14 ref|XP_022042450.1| putative pentatricopeptide repeat-containing... 71 1e-13 ref|XP_022029908.1| putative pentatricopeptide repeat-containing... 71 1e-13 ref|XP_022029936.1| putative pentatricopeptide repeat-containing... 69 1e-13 ref|XP_022029937.1| putative pentatricopeptide repeat-containing... 71 1e-13 ref|XP_022029946.1| putative pentatricopeptide repeat-containing... 70 2e-13 ref|XP_022029992.1| putative pentatricopeptide repeat-containing... 70 2e-13 ref|XP_022029910.1| putative pentatricopeptide repeat-containing... 67 3e-13 gb|OTG32816.1| putative pentatricopeptide repeat (PPR) superfami... 69 3e-13 ref|XP_022031613.1| pentatricopeptide repeat-containing protein ... 69 3e-13 gb|OTG32820.1| putative pentatricopeptide repeat protein [Helian... 71 3e-13 ref|XP_022031616.1| putative pentatricopeptide repeat-containing... 71 3e-13 ref|XP_022029911.1| putative pentatricopeptide repeat-containing... 67 4e-13 ref|XP_022029943.1| putative pentatricopeptide repeat-containing... 67 5e-13 gb|OTG32868.1| putative tetratricopeptide-like helical domain-co... 69 5e-13 gb|OTG32865.1| putative tetratricopeptide-like helical domain-co... 70 6e-13 >ref|XP_022029909.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32824.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 606 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KSLFLKMEESGCTPNNVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 32.7 bits (73), Expect(2) = 3e-14 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 597 >gb|OTG23304.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 599 Score = 73.2 bits (178), Expect(2) = 3e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KSLFLKMEESGCTPNNVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 32.7 bits (73), Expect(2) = 3e-14 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 597 >gb|OTG23302.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 591 Score = 70.9 bits (172), Expect(2) = 3e-14 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 500 KLLFLKMEESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 544 Score = 35.0 bits (79), Expect(2) = 3e-14 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL+ E +D P D Sbjct: 544 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLSKLVPKELLDDPRLCD 589 >gb|OTG32860.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 599 Score = 72.4 bits (176), Expect(2) = 5e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KSLFLKMEESGCPPNNVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 32.7 bits (73), Expect(2) = 5e-14 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 597 >ref|XP_022031630.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] Length = 496 Score = 72.4 bits (176), Expect(2) = 5e-14 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 405 KSLFLKMEESGCPPNNVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 449 Score = 32.7 bits (73), Expect(2) = 5e-14 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 449 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 494 >ref|XP_022042450.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] Length = 599 Score = 70.9 bits (172), Expect(2) = 1e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KLLFLKMEESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 33.1 bits (74), Expect(2) = 1e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDDIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 597 >ref|XP_022029908.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32822.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 599 Score = 70.9 bits (172), Expect(2) = 1e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KLLFLKMEESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 32.7 bits (73), Expect(2) = 1e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPRLCD 597 >ref|XP_022029936.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32855.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 599 Score = 68.6 bits (166), Expect(2) = 1e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQGYLK +HYDDVEMLL++MD++ Sbjct: 508 KLLFLKMEESGCPPDDVTYRVLLQGYLKKRHYDDVEMLLQEMDDR 552 Score = 35.0 bits (79), Expect(2) = 1e-13 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL+ E +D P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLSKLVPKELLDDPRLCD 597 >ref|XP_022029937.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] ref|XP_022029938.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] ref|XP_022029940.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] ref|XP_022029941.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] ref|XP_022029942.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32858.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 591 Score = 70.9 bits (172), Expect(2) = 1e-13 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 500 KLLFLKMEESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 544 Score = 32.7 bits (73), Expect(2) = 1e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 544 RGYSLDASTLSLFIDHIAAGLLDRSMLKLLGKLVPKELLNDPRLCD 589 >ref|XP_022029946.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32866.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 599 Score = 69.7 bits (169), Expect(2) = 2e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKM+ES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 508 KLLFLKMDESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 552 Score = 33.1 bits (74), Expect(2) = 2e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 552 RGYSLDASTLSLFIDDIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 597 >ref|XP_022029992.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32906.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 591 Score = 69.7 bits (169), Expect(2) = 2e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKM+ES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 500 KLLFLKMDESGCPPDDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 544 Score = 33.1 bits (74), Expect(2) = 2e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 544 RGYSLDASTLSLFIDDIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 589 >ref|XP_022029910.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32831.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 612 Score = 67.4 bits (163), Expect(2) = 3e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LF KMEES C P+T TY VLLQGYLKN HYD+VEMLL++MD++ Sbjct: 519 KYLFHKMEESGCPPNTVTYCVLLQGYLKNNHYDNVEMLLQEMDDR 563 Score = 35.0 bits (79), Expect(2) = 3e-13 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP 260 R + L TLSLF + +AAG LDRS+L L N E +D P Sbjct: 563 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFNKLVPKELLDDP 604 >gb|OTG32816.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 599 Score = 68.9 bits (167), Expect(2) = 3e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQG+LKN+HYDDVEMLL++MD++ Sbjct: 508 KLLFLKMEESGCPPDDVTYRVLLQGHLKNRHYDDVEMLLQEMDDR 552 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L+ E +D P D Sbjct: 552 RGYSLDASTLSLFIDHIAAGLLDRSMLKFLSKLVPKELLDDPRLCD 597 >ref|XP_022031613.1| pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Helianthus annuus] Length = 598 Score = 68.9 bits (167), Expect(2) = 3e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P TY VLLQG+LKN+HYDDVEMLL++MD++ Sbjct: 507 KLLFLKMEESGCPPDDVTYRVLLQGHLKNRHYDDVEMLLQEMDDR 551 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L+ E +D P D Sbjct: 551 RGYSLDASTLSLFIDHIAAGLLDRSMLKFLSKLVPKELLDDPRLCD 596 >gb|OTG32820.1| putative pentatricopeptide repeat protein [Helianthus annuus] Length = 565 Score = 71.2 bits (173), Expect(2) = 3e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 474 KLLFLKMEESGCPPNDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 518 Score = 31.2 bits (69), Expect(2) = 3e-13 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L E ++ P D Sbjct: 518 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFGKLVPKELLNDPSLCD 563 >ref|XP_022031616.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] Length = 559 Score = 71.2 bits (173), Expect(2) = 3e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 468 KLLFLKMEESGCPPNDVTYRVLLQGYLKNRHYDDVEMLLQEMDDR 512 Score = 31.2 bits (69), Expect(2) = 3e-13 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L E ++ P D Sbjct: 512 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFGKLVPKELLNDPSLCD 557 >ref|XP_022029911.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32830.1| putative pentatricopeptide repeat-containing protein [Helianthus annuus] Length = 608 Score = 66.6 bits (161), Expect(2) = 4e-13 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY VLLQG LKNKHYDDVEMLL++MD + Sbjct: 515 KLLFLKMEESGCPPNNITYCVLLQGCLKNKHYDDVEMLLKEMDAR 559 Score = 35.4 bits (80), Expect(2) = 4e-13 Identities = 21/46 (45%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L N E +D P D Sbjct: 559 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFNKLVPKELLDDPRLCD 604 >ref|XP_022029943.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG32861.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 608 Score = 66.6 bits (161), Expect(2) = 5e-13 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKMEES C P+ TY V LQG LKNKHYDDVEMLL++MD++ Sbjct: 515 KLLFLKMEESGCPPNNITYCVFLQGCLKNKHYDDVEMLLQEMDDR 559 Score = 35.0 bits (79), Expect(2) = 5e-13 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP 260 R + L TLSLF + +AAG LDRS+L L N E +D P Sbjct: 559 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFNKLVPKELLDDP 600 >gb|OTG32868.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 441 Score = 68.6 bits (166), Expect(2) = 5e-13 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMDEK 136 K LFLKM+ES C P TY VLLQGYLKN+HYDDVEMLL++MD++ Sbjct: 352 KLLFLKMDESGCPPDDVTYCVLLQGYLKNRHYDDVEMLLQEMDDR 396 Score = 33.1 bits (74), Expect(2) = 5e-13 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L LL E ++ P D Sbjct: 396 RGYSLDASTLSLFIDDIAAGLLDRSMLKLLGKLVPKELLNDPSLCD 441 >gb|OTG32865.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 591 Score = 69.7 bits (169), Expect(2) = 6e-13 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 2 KQLFLKMEESVCWPSTDTYNVLLQGYLKNKHYDDVEMLLEKMD 130 K LFLKMEES C P+ TY VLLQGYLKN+HYDDVEMLL++MD Sbjct: 500 KLLFLKMEESGCPPNDVTYRVLLQGYLKNRHYDDVEMLLQEMD 542 Score = 31.6 bits (70), Expect(2) = 6e-13 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 135 RNHRLYDLTLSLFHESVAAGSLDRSILNLLNNFPR*EEMDFP*FSD 272 R + L TLSLF + +AAG LDRS+L L E ++ P D Sbjct: 544 RGYSLDASTLSLFIDHIAAGLLDRSMLKLFGKLVAKELLNDPRLCD 589