BLASTX nr result
ID: Chrysanthemum22_contig00044180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00044180 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88206.1| Leucine-rich repeat-containing protein [Cynara ca... 139 4e-35 gb|PLY89708.1| hypothetical protein LSAT_7X29400 [Lactuca sativa] 135 7e-34 ref|XP_023758154.1| 187-kDa microtubule-associated protein AIR9 ... 135 7e-34 ref|XP_023758150.1| 187-kDa microtubule-associated protein AIR9 ... 135 7e-34 ref|XP_022035558.1| 187-kDa microtubule-associated protein AIR9 ... 132 1e-32 ref|XP_022035556.1| 187-kDa microtubule-associated protein AIR9 ... 132 1e-32 ref|XP_008372215.1| PREDICTED: 187-kDa microtubule-associated pr... 125 3e-30 dbj|GAV67239.1| LRR_4 domain-containing protein [Cephalotus foll... 125 4e-30 ref|XP_021812390.1| 187-kDa microtubule-associated protein AIR9 ... 124 8e-30 ref|XP_008225584.1| PREDICTED: 187-kDa microtubule-associated pr... 124 8e-30 ref|XP_007213737.1| 187-kDa microtubule-associated protein AIR9 ... 124 8e-30 gb|ONI11138.1| hypothetical protein PRUPE_4G089200 [Prunus persica] 124 8e-30 gb|ONI11139.1| hypothetical protein PRUPE_4G089200 [Prunus persica] 124 8e-30 ref|XP_019078155.1| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_002274947.2| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_010655726.1| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_019078154.1| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_019078153.1| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_019078150.1| PREDICTED: 187-kDa microtubule-associated pr... 123 1e-29 ref|XP_019057902.1| PREDICTED: 187-kDa microtubule-associated pr... 120 1e-28 >gb|KVH88206.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 1661 Score = 139 bits (350), Expect = 4e-35 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 E+MST+SSQRKA T E+RVSRLIMLP+VEIKA DDVRLDLRGHRIR+LKA+GLNLSPNLE Sbjct: 240 EKMSTSSSQRKATTPEIRVSRLIMLPQVEIKAGDDVRLDLRGHRIRTLKASGLNLSPNLE 299 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGI+ LK VKVL Sbjct: 300 FVYLRDNLLSSLEGIDILKRVKVL 323 >gb|PLY89708.1| hypothetical protein LSAT_7X29400 [Lactuca sativa] Length = 1670 Score = 135 bits (341), Expect = 7e-34 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGIE LK VKVL Sbjct: 280 FVYLRDNLLSSLEGIEILKRVKVL 303 >ref|XP_023758154.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Lactuca sativa] Length = 1691 Score = 135 bits (341), Expect = 7e-34 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGIE LK VKVL Sbjct: 280 FVYLRDNLLSSLEGIEILKRVKVL 303 >ref|XP_023758150.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758151.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758152.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] ref|XP_023758153.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Lactuca sativa] Length = 1692 Score = 135 bits (341), Expect = 7e-34 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 ERMST+SSQRKAAT E+R+SRLIMLP+VE KA+DDVRLDLRGHRIRSLKA G+N+SPNLE Sbjct: 221 ERMSTSSSQRKAATPEIRISRLIMLPQVETKANDDVRLDLRGHRIRSLKA-GMNMSPNLE 279 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGIE LK VKVL Sbjct: 280 FVYLRDNLLSSLEGIEILKRVKVL 303 >ref|XP_022035558.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Helianthus annuus] gb|OTG29148.1| putative outer arm dynein light chain 1 protein [Helianthus annuus] Length = 1672 Score = 132 bits (332), Expect = 1e-32 Identities = 71/84 (84%), Positives = 74/84 (88%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 ERMSTASS RKA T +VSRLIMLP+VE KA DDVRLDLRGHRIRSLKA+GLNLSPNLE Sbjct: 201 ERMSTASSLRKAVTPAFKVSRLIMLPQVETKAGDDVRLDLRGHRIRSLKASGLNLSPNLE 260 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGIE L VKVL Sbjct: 261 FVYLRDNLLSSLEGIEILNRVKVL 284 >ref|XP_022035556.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Helianthus annuus] ref|XP_022035557.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Helianthus annuus] Length = 1673 Score = 132 bits (332), Expect = 1e-32 Identities = 71/84 (84%), Positives = 74/84 (88%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 ERMSTASS RKA T +VSRLIMLP+VE KA DDVRLDLRGHRIRSLKA+GLNLSPNLE Sbjct: 201 ERMSTASSLRKAVTPAFKVSRLIMLPQVETKAGDDVRLDLRGHRIRSLKASGLNLSPNLE 260 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLSSLEGIE L VKVL Sbjct: 261 FVYLRDNLLSSLEGIEILNRVKVL 284 >ref|XP_008372215.1| PREDICTED: 187-kDa microtubule-associated protein AIR9-like [Malus domestica] ref|XP_008372216.1| PREDICTED: 187-kDa microtubule-associated protein AIR9-like [Malus domestica] Length = 1713 Score = 125 bits (314), Expect = 3e-30 Identities = 64/84 (76%), Positives = 74/84 (88%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RK AT+E R SR I+LP+VEIKASDD+RLDLRGHR+RSLKANGLNLSPNLE Sbjct: 241 DRSSSLSGRRKTATHESRDSRFIVLPQVEIKASDDLRLDLRGHRVRSLKANGLNLSPNLE 300 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E L VKVL Sbjct: 301 FVYLRDNLLSTLEGVEILARVKVL 324 >dbj|GAV67239.1| LRR_4 domain-containing protein [Cephalotus follicularis] Length = 1719 Score = 125 bits (313), Expect = 4e-30 Identities = 66/84 (78%), Positives = 72/84 (85%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R ST S +RK+AT E R SR IMLP VE+KA DDVRLDLRGHRIRSL A+GLNLSPNLE Sbjct: 247 QRSSTLSGRRKSATPESRDSRFIMLPLVEVKAGDDVRLDLRGHRIRSLNASGLNLSPNLE 306 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEGIE LK VKVL Sbjct: 307 FVYLRDNLLSTLEGIEILKRVKVL 330 >ref|XP_021812390.1| 187-kDa microtubule-associated protein AIR9 [Prunus avium] ref|XP_021812391.1| 187-kDa microtubule-associated protein AIR9 [Prunus avium] Length = 1718 Score = 124 bits (311), Expect = 8e-30 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS LEG+E L VKVL Sbjct: 306 FVYLRDNLLSMLEGVEILTRVKVL 329 >ref|XP_008225584.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 [Prunus mume] ref|XP_008225585.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 [Prunus mume] Length = 1718 Score = 124 bits (311), Expect = 8e-30 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS LEG+E L VKVL Sbjct: 306 FVYLRDNLLSMLEGVEILTRVKVL 329 >ref|XP_007213737.1| 187-kDa microtubule-associated protein AIR9 isoform X2 [Prunus persica] ref|XP_020417374.1| 187-kDa microtubule-associated protein AIR9 isoform X1 [Prunus persica] gb|ONI11137.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1718 Score = 124 bits (311), Expect = 8e-30 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS LEG+E L VKVL Sbjct: 306 FVYLRDNLLSMLEGVEILTRVKVL 329 >gb|ONI11138.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1726 Score = 124 bits (311), Expect = 8e-30 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS LEG+E L VKVL Sbjct: 306 FVYLRDNLLSMLEGVEILTRVKVL 329 >gb|ONI11139.1| hypothetical protein PRUPE_4G089200 [Prunus persica] Length = 1778 Score = 124 bits (311), Expect = 8e-30 Identities = 65/84 (77%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SRLI+LPKVEIKA DD+RLDLRGHR+RSLKA+GLNLSPNLE Sbjct: 246 DRSSSLSGRRKAATPEGRDSRLIVLPKVEIKAGDDLRLDLRGHRVRSLKASGLNLSPNLE 305 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS LEG+E L VKVL Sbjct: 306 FVYLRDNLLSMLEGVEILTRVKVL 329 >ref|XP_019078155.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X6 [Vitis vinifera] Length = 1639 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_002274947.2| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X5 [Vitis vinifera] emb|CBI30992.3| unnamed protein product, partial [Vitis vinifera] Length = 1717 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_010655726.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X4 [Vitis vinifera] Length = 1725 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_019078154.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X3 [Vitis vinifera] Length = 1734 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_019078153.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X2 [Vitis vinifera] Length = 1740 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_019078150.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] ref|XP_019078151.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] ref|XP_019078152.1| PREDICTED: 187-kDa microtubule-associated protein AIR9 isoform X1 [Vitis vinifera] Length = 1741 Score = 123 bits (309), Expect = 1e-29 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S+ S +RKAAT E R SR I+LP+VEIKA DDVRLDLRGHR+RSL A+GLNLSPNLE Sbjct: 245 DRSSSFSGRRKAATPESRDSRFIVLPQVEIKAGDDVRLDLRGHRVRSLNASGLNLSPNLE 304 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 305 FVYLRDNLLSTLEGVEILKRVKVL 328 >ref|XP_019057902.1| PREDICTED: 187-kDa microtubule-associated protein AIR9, partial [Tarenaya hassleriana] Length = 1135 Score = 120 bits (302), Expect = 1e-28 Identities = 62/84 (73%), Positives = 73/84 (86%) Frame = -1 Query: 253 ERMSTASSQRKAATNEVRVSRLIMLPKVEIKASDDVRLDLRGHRIRSLKANGLNLSPNLE 74 +R S S ++K AT E R SRL++LP+VE+KAS+DVRLDLRGHRIRSL A+GLNLSPNLE Sbjct: 238 DRSSKFSGRKKTATPESRDSRLVILPQVEVKASNDVRLDLRGHRIRSLNASGLNLSPNLE 297 Query: 73 FVYLRDNLLSSLEGIEKLKLVKVL 2 FVYLRDNLLS+LEG+E LK VKVL Sbjct: 298 FVYLRDNLLSTLEGVEILKQVKVL 321