BLASTX nr result
ID: Chrysanthemum22_contig00043725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00043725 (626 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY95999.1| hypothetical protein LSAT_9X38660 [Lactuca sativa] 59 8e-07 ref|XP_023749893.1| probable WRKY transcription factor 38 [Lactu... 59 9e-07 ref|XP_023749894.1| probable WRKY transcription factor 70 [Lactu... 57 3e-06 >gb|PLY95999.1| hypothetical protein LSAT_9X38660 [Lactuca sativa] Length = 296 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 323 RNNSWTSTKVTSLDFDDGHE*RKYGQKGILNAKHKRFFY 439 R SWTSTKVTSL DDGH RKYGQK I+NAKHKR +Y Sbjct: 91 RKRSWTSTKVTSL-IDDGHVWRKYGQKEIINAKHKRNYY 128 >ref|XP_023749893.1| probable WRKY transcription factor 38 [Lactuca sativa] Length = 314 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 323 RNNSWTSTKVTSLDFDDGHE*RKYGQKGILNAKHKRFFY 439 R SWTSTKVTSL DDGH RKYGQK I+NAKHKR +Y Sbjct: 109 RKRSWTSTKVTSL-IDDGHVWRKYGQKEIINAKHKRNYY 146 >ref|XP_023749894.1| probable WRKY transcription factor 70 [Lactuca sativa] gb|PLY95983.1| hypothetical protein LSAT_9X38680 [Lactuca sativa] Length = 305 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +2 Query: 323 RNNSWTSTKVTSLDFDDGHE*RKYGQKGILNAKHKRFFY 439 R +SWTSTKVTS DDGH RKYGQK ILNA H+R +Y Sbjct: 118 RKSSWTSTKVTSDLIDDGHAWRKYGQKEILNANHQRSYY 156