BLASTX nr result
ID: Chrysanthemum22_contig00043590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00043590 (812 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021979326.1| helicase protein MOM1-like [Helianthus annuus] 64 8e-08 gb|OTG37482.1| putative P-loop containing nucleoside triphosphat... 64 8e-08 >ref|XP_021979326.1| helicase protein MOM1-like [Helianthus annuus] Length = 1977 Score = 64.3 bits (155), Expect = 8e-08 Identities = 33/76 (43%), Positives = 46/76 (60%) Frame = +2 Query: 14 IRPLFSSNPFRTFAATSRINTETCGQSPQGRPLVSSVTHSTAPHMRPMVSREVRAPGPHL 193 IRPL SS P A R ++E P RPL+ S + PH+RP+V+RE RAP PH+ Sbjct: 1790 IRPLVSSEPCAP-APNIRPSSEPRAPPPNIRPLLGSEPRAPPPHLRPLVNREPRAPAPHM 1848 Query: 194 RPLARSDVRSSTSHMR 241 R LA +++R+ H+R Sbjct: 1849 RSLASTEIRARAPHLR 1864 >gb|OTG37482.1| putative P-loop containing nucleoside triphosphate hydrolase [Helianthus annuus] Length = 1983 Score = 64.3 bits (155), Expect = 8e-08 Identities = 33/76 (43%), Positives = 46/76 (60%) Frame = +2 Query: 14 IRPLFSSNPFRTFAATSRINTETCGQSPQGRPLVSSVTHSTAPHMRPMVSREVRAPGPHL 193 IRPL SS P A R ++E P RPL+ S + PH+RP+V+RE RAP PH+ Sbjct: 1796 IRPLVSSEPCAP-APNIRPSSEPRAPPPNIRPLLGSEPRAPPPHLRPLVNREPRAPAPHM 1854 Query: 194 RPLARSDVRSSTSHMR 241 R LA +++R+ H+R Sbjct: 1855 RSLASTEIRARAPHLR 1870