BLASTX nr result
ID: Chrysanthemum22_contig00043562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00043562 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69096.1| hypothetical protein VITISV_025437 [Vitis vinifera] 58 1e-06 emb|CAN65237.1| hypothetical protein VITISV_018674 [Vitis vinifera] 57 2e-06 >emb|CAN69096.1| hypothetical protein VITISV_025437 [Vitis vinifera] Length = 992 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 107 LEPDEWIKDSGCSRHMTGNKSLFSSYQEYDGGNVT 3 +E W DSGCS HMTGNKSLF+S+ E+DGGNVT Sbjct: 52 IESHSWYLDSGCSHHMTGNKSLFTSFTEFDGGNVT 86 >emb|CAN65237.1| hypothetical protein VITISV_018674 [Vitis vinifera] Length = 563 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 104 EPDEWIKDSGCSRHMTGNKSLFSSYQEYDGGNVT 3 E W DSGCS HMTGNKSLF+S+ E+DGGNVT Sbjct: 384 ESHSWYLDSGCSHHMTGNKSLFTSFTEFDGGNVT 417