BLASTX nr result
ID: Chrysanthemum22_contig00042998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00042998 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP46745.1| hypothetical protein JCGZ_06533 [Jatropha curcas] 111 9e-28 ref|XP_021987868.1| pentatricopeptide repeat-containing protein ... 118 3e-27 gb|KVF06906.1| Pentatricopeptide repeat-containing protein, part... 116 9e-27 ref|XP_023002238.1| pentatricopeptide repeat-containing protein ... 115 3e-26 gb|PRQ20510.1| putative DYW domain-containing protein [Rosa chin... 107 3e-26 dbj|GAV72319.1| PPR domain-containing protein/PPR_2 domain-conta... 114 4e-26 ref|XP_023537093.1| pentatricopeptide repeat-containing protein ... 114 4e-26 ref|XP_022951057.1| pentatricopeptide repeat-containing protein ... 114 4e-26 ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containi... 114 4e-26 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 114 4e-26 gb|KDO84746.1| hypothetical protein CISIN_1g0038681mg, partial [... 114 5e-26 gb|PNT47478.1| hypothetical protein POPTR_002G027800v3 [Populus ... 114 6e-26 ref|XP_022997583.1| pentatricopeptide repeat-containing protein ... 114 8e-26 gb|PKI77401.1| hypothetical protein CRG98_002174 [Punica granatum] 114 8e-26 ref|XP_022997582.1| pentatricopeptide repeat-containing protein ... 114 8e-26 dbj|GAY42979.1| hypothetical protein CUMW_071080 [Citrus unshiu] 114 8e-26 gb|OWM75010.1| hypothetical protein CDL15_Pgr021361 [Punica gran... 114 8e-26 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 114 8e-26 ref|XP_006435103.1| pentatricopeptide repeat-containing protein ... 114 8e-26 ref|XP_023733167.1| pentatricopeptide repeat-containing protein ... 114 8e-26 >gb|KDP46745.1| hypothetical protein JCGZ_06533 [Jatropha curcas] Length = 161 Score = 111 bits (278), Expect = 9e-28 Identities = 47/65 (72%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L++ GA +RVFKN+RICGDCHNAFK+MS+VV REIVVRDGKRFHHF+DGKCS Sbjct: 97 LAVAFGLMRLPRGATVRVFKNLRICGDCHNAFKYMSKVVSREIVVRDGKRFHHFRDGKCS 156 Query: 181 CGNYW 195 CG+YW Sbjct: 157 CGDYW 161 >ref|XP_021987868.1| pentatricopeptide repeat-containing protein At1g25360 [Helianthus annuus] gb|OTG10392.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 803 Score = 118 bits (295), Expect = 3e-27 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GAM+RVFKNIRICGDCHNAFKFMS+VV REIVVRDGKRFHHFKDG CS Sbjct: 739 LAVAFGLLKLPSGAMVRVFKNIRICGDCHNAFKFMSQVVEREIVVRDGKRFHHFKDGNCS 798 Query: 181 CGNYW 195 CGNYW Sbjct: 799 CGNYW 803 >gb|KVF06906.1| Pentatricopeptide repeat-containing protein, partial [Cynara cardunculus var. scolymus] Length = 817 Score = 116 bits (291), Expect = 9e-27 Identities = 51/65 (78%), Positives = 58/65 (89%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GAMIRVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHF++GKCS Sbjct: 753 LAVAFGLLKLPSGAMIRVFKNLRICGDCHNAFKFMSQVVEREIVVRDGKRFHHFRNGKCS 812 Query: 181 CGNYW 195 CGNYW Sbjct: 813 CGNYW 817 >ref|XP_023002238.1| pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita maxima] Length = 797 Score = 115 bits (287), Expect = 3e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 19 LVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCSCGNYW 195 L+K PGA +RVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHFK+G+CSCGNYW Sbjct: 739 LMKLPPGATVRVFKNLRICGDCHNAFKFMSQVVRREIVVRDGKRFHHFKNGECSCGNYW 797 >gb|PRQ20510.1| putative DYW domain-containing protein [Rosa chinensis] Length = 144 Score = 107 bits (266), Expect = 3e-26 Identities = 45/65 (69%), Positives = 55/65 (84%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A ++K GA IRVFKN+RICGDCHNAFK++S VVGREI VRD KRFHHF++G+CS Sbjct: 80 LAVAFGIMKLPLGATIRVFKNLRICGDCHNAFKYVSRVVGREIAVRDAKRFHHFRNGECS 139 Query: 181 CGNYW 195 CGNYW Sbjct: 140 CGNYW 144 >dbj|GAV72319.1| PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 743 Score = 114 bits (286), Expect = 4e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K G +RVFKN+RICGDCHN+FKF+SEVVGREIVVRDGKRFHHFKDGKCS Sbjct: 679 LAVAFGLMKLPRGTTVRVFKNLRICGDCHNSFKFISEVVGREIVVRDGKRFHHFKDGKCS 738 Query: 181 CGNYW 195 CG+YW Sbjct: 739 CGDYW 743 >ref|XP_023537093.1| pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita pepo subsp. pepo] Length = 766 Score = 114 bits (286), Expect = 4e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 19 LVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCSCGNYW 195 L+K PGA +RVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHFK+G+CSCGNYW Sbjct: 708 LMKLPPGATVRVFKNLRICGDCHNAFKFMSKVVRREIVVRDGKRFHHFKNGECSCGNYW 766 >ref|XP_022951057.1| pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita moschata] Length = 797 Score = 114 bits (286), Expect = 4e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 19 LVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCSCGNYW 195 L+K PGA +RVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHFK+G+CSCGNYW Sbjct: 739 LMKLPPGATVRVFKNLRICGDCHNAFKFMSKVVRREIVVRDGKRFHHFKNGECSCGNYW 797 >ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] ref|XP_011028951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] ref|XP_011028952.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] Length = 797 Score = 114 bits (286), Expect = 4e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A +K GA +RVFKN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 733 LAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 792 Query: 181 CGNYW 195 CG+YW Sbjct: 793 CGDYW 797 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 114 bits (286), Expect = 4e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A +K GA +RVFKN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 733 LAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 792 Query: 181 CGNYW 195 CG+YW Sbjct: 793 CGDYW 797 >gb|KDO84746.1| hypothetical protein CISIN_1g0038681mg, partial [Citrus sinensis] Length = 519 Score = 114 bits (284), Expect = 5e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RV KN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 455 LAVAFGLMKLPGGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 514 Query: 181 CGNYW 195 CG+YW Sbjct: 515 CGDYW 519 >gb|PNT47478.1| hypothetical protein POPTR_002G027800v3 [Populus trichocarpa] Length = 797 Score = 114 bits (285), Expect = 6e-26 Identities = 48/65 (73%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A +K GA +RVFKN+RICGDCHNAFKFMS+VVGREI+VRDGKRFHHF+DGKCS Sbjct: 733 LAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIIVRDGKRFHHFRDGKCS 792 Query: 181 CGNYW 195 CG+YW Sbjct: 793 CGDYW 797 >ref|XP_022997583.1| pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Cucurbita maxima] Length = 733 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 V +A L+K PGA +RVFKN+RICGDCHNAFKFMS+VV REI+VRD KRFHHFK+G+CS Sbjct: 669 VAVAFGLMKLPPGATVRVFKNLRICGDCHNAFKFMSKVVKREIIVRDRKRFHHFKNGECS 728 Query: 181 CGNYW 195 CGNYW Sbjct: 729 CGNYW 733 >gb|PKI77401.1| hypothetical protein CRG98_002174 [Punica granatum] Length = 760 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHF+DG+CS Sbjct: 696 LAVAFGLMKLPQGATVRVFKNLRICGDCHNAFKFMSKVVQREIVVRDGKRFHHFRDGECS 755 Query: 181 CGNYW 195 CGNYW Sbjct: 756 CGNYW 760 >ref|XP_022997582.1| pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Cucurbita maxima] Length = 797 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 V +A L+K PGA +RVFKN+RICGDCHNAFKFMS+VV REI+VRD KRFHHFK+G+CS Sbjct: 733 VAVAFGLMKLPPGATVRVFKNLRICGDCHNAFKFMSKVVKREIIVRDRKRFHHFKNGECS 792 Query: 181 CGNYW 195 CGNYW Sbjct: 793 CGNYW 797 >dbj|GAY42979.1| hypothetical protein CUMW_071080 [Citrus unshiu] Length = 799 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RV KN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 735 LAVAFGLMKLPGGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 794 Query: 181 CGNYW 195 CG+YW Sbjct: 795 CGDYW 799 >gb|OWM75010.1| hypothetical protein CDL15_Pgr021361 [Punica granatum] Length = 799 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RVFKN+RICGDCHNAFKFMS+VV REIVVRDGKRFHHF+DG+CS Sbjct: 735 LAVAFGLMKLPQGATVRVFKNLRICGDCHNAFKFMSKVVQREIVVRDGKRFHHFRDGECS 794 Query: 181 CGNYW 195 CGNYW Sbjct: 795 CGNYW 799 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Citrus sinensis] ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Citrus sinensis] Length = 799 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RV KN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 735 LAVAFGLMKLPHGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 794 Query: 181 CGNYW 195 CG+YW Sbjct: 795 CGDYW 799 >ref|XP_006435103.1| pentatricopeptide repeat-containing protein At1g25360 [Citrus clementina] gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GA +RV KN+RICGDCHNAFKFMS+VVGREIVVRDGKRFHHF+DGKCS Sbjct: 735 LAVAFGLMKLPGGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCS 794 Query: 181 CGNYW 195 CG+YW Sbjct: 795 CGDYW 799 >ref|XP_023733167.1| pentatricopeptide repeat-containing protein At1g25360 [Lactuca sativa] ref|XP_023733168.1| pentatricopeptide repeat-containing protein At1g25360 [Lactuca sativa] gb|PLY74333.1| hypothetical protein LSAT_6X940 [Lactuca sativa] Length = 813 Score = 114 bits (284), Expect = 8e-26 Identities = 49/65 (75%), Positives = 58/65 (89%) Frame = +1 Query: 1 VGIAVVLVKRAPGAMIRVFKNIRICGDCHNAFKFMSEVVGREIVVRDGKRFHHFKDGKCS 180 + +A L+K GAMIRVFKN+RICGDCHNAF+FMS+VV R+IVVRDGKRFHHF++GKCS Sbjct: 749 LAVAFGLLKLPSGAMIRVFKNLRICGDCHNAFEFMSQVVERDIVVRDGKRFHHFRNGKCS 808 Query: 181 CGNYW 195 CGNYW Sbjct: 809 CGNYW 813