BLASTX nr result
ID: Chrysanthemum22_contig00042740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00042740 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009355877.1| ribosomal protein S19 (mitochondrion) [Diplo... 83 7e-19 >ref|YP_009355877.1| ribosomal protein S19 (mitochondrion) [Diplostephium hartwegii] gb|AOW70649.1| ribosomal protein S19 (mitochondrion) [Diplostephium hartwegii] Length = 56 Score = 83.2 bits (204), Expect = 7e-19 Identities = 39/44 (88%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = +1 Query: 34 NSKLSIKKFPHFNEEECKITEG--GHQFGEFAFTRKHPTYTISR 159 NSKLS KKFPHFNEEECKITEG GH+FGEFAFTRKHPTYTIS+ Sbjct: 7 NSKLSSKKFPHFNEEECKITEGKVGHKFGEFAFTRKHPTYTISQ 50