BLASTX nr result
ID: Chrysanthemum22_contig00042604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00042604 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021296314.1| leucine-rich repeat extensin-like protein 3 ... 51 7e-06 gb|KNF06507.1| hypothetical protein, variant [Puccinia striiform... 53 9e-06 gb|KNF06506.1| hypothetical protein PSTG_00383 [Puccinia striifo... 53 1e-05 >ref|XP_021296314.1| leucine-rich repeat extensin-like protein 3 [Herrania umbratica] Length = 109 Score = 51.2 bits (121), Expect = 7e-06 Identities = 27/69 (39%), Positives = 32/69 (46%) Frame = +2 Query: 2 PKPFEPLPNNPVTPHCEPPPYY*NGSNGQTPPNQMYCSSPSPSPVKPNTSGFSPPPHHPQ 181 P PF P P+ P P PPP N PP Q+Y + P P P +P+ PPP H Sbjct: 8 PHPFAPPPSPPQDPFAPPPP----PRNPFAPPPQVYGAPPPPPPPRPDYYAPPPPPPH-- 61 Query: 182 LSKNTHHHP 208 HHHP Sbjct: 62 -----HHHP 65 >gb|KNF06507.1| hypothetical protein, variant [Puccinia striiformis f. sp. tritici PST-78] Length = 273 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +2 Query: 17 PLPNNPVTPHCEPPPYY*NGSNGQTPPNQMYCSSPSPSP-VKPNTSGFSPPPHHPQLSKN 193 P P + + PH PPP+Y + SN + S+PSP P + P+ P PHHP L++N Sbjct: 134 PQPQHHLPPHHPPPPFYASNSNS-------HSSAPSPYPHIVPHPQHPHPHPHHPHLNQN 186 Query: 194 THHHP 208 HHHP Sbjct: 187 -HHHP 190 >gb|KNF06506.1| hypothetical protein PSTG_00383 [Puccinia striiformis f. sp. tritici PST-78] Length = 288 Score = 53.1 bits (126), Expect = 1e-05 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +2 Query: 17 PLPNNPVTPHCEPPPYY*NGSNGQTPPNQMYCSSPSPSP-VKPNTSGFSPPPHHPQLSKN 193 P P + + PH PPP+Y + SN + S+PSP P + P+ P PHHP L++N Sbjct: 134 PQPQHHLPPHHPPPPFYASNSNS-------HSSAPSPYPHIVPHPQHPHPHPHHPHLNQN 186 Query: 194 THHHP 208 HHHP Sbjct: 187 -HHHP 190