BLASTX nr result
ID: Chrysanthemum22_contig00042505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00042505 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021997737.1| ubiquitin-like-specific protease 1D isoform ... 62 2e-08 ref|XP_021997736.1| ubiquitin-like-specific protease 1D isoform ... 62 2e-08 ref|XP_021997735.1| ubiquitin-like-specific protease 1D isoform ... 62 2e-08 gb|KVH96072.1| Peptidase C48, SUMO/Sentrin/Ubl1, partial [Cynara... 59 2e-07 gb|PLY90220.1| hypothetical protein LSAT_8X157321 [Lactuca sativa] 59 3e-07 ref|XP_022012910.1| ubiquitin-like-specific protease 1D isoform ... 55 7e-06 >ref|XP_021997737.1| ubiquitin-like-specific protease 1D isoform X3 [Helianthus annuus] Length = 504 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAALSPE 128 SMFGKQWF PEEAS+LR IN+LLV EFKIAKEKET LSP+ Sbjct: 463 SMFGKQWFLPEEASSLRVRINNLLVQEFKIAKEKET-ILSPK 503 >ref|XP_021997736.1| ubiquitin-like-specific protease 1D isoform X2 [Helianthus annuus] gb|OTG04993.1| putative cysteine proteinases superfamily protein [Helianthus annuus] Length = 528 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAALSPE 128 SMFGKQWF PEEAS+LR IN+LLV EFKIAKEKET LSP+ Sbjct: 487 SMFGKQWFLPEEASSLRVRINNLLVQEFKIAKEKET-ILSPK 527 >ref|XP_021997735.1| ubiquitin-like-specific protease 1D isoform X1 [Helianthus annuus] Length = 529 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAALSPE 128 SMFGKQWF PEEAS+LR IN+LLV EFKIAKEKET LSP+ Sbjct: 488 SMFGKQWFLPEEASSLRVRINNLLVQEFKIAKEKET-ILSPK 528 >gb|KVH96072.1| Peptidase C48, SUMO/Sentrin/Ubl1, partial [Cynara cardunculus var. scolymus] Length = 618 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAA 116 SMFGKQWF PEEASNLR I++LLV EFK AKEKE A+ Sbjct: 577 SMFGKQWFHPEEASNLRVRIHNLLVQEFKSAKEKEKAS 614 >gb|PLY90220.1| hypothetical protein LSAT_8X157321 [Lactuca sativa] Length = 501 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAALS 122 SMFGKQWF P+EASNLR I++LLV +FKIAK+KET + S Sbjct: 461 SMFGKQWFMPQEASNLRRRISNLLVQQFKIAKQKETISSS 500 >ref|XP_022012910.1| ubiquitin-like-specific protease 1D isoform X1 [Helianthus annuus] gb|OTF96077.1| putative ulp1 protease family, C-terminal catalytic domain-containing protein [Helianthus annuus] Length = 529 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 SMFGKQWFRPEEASNLRWTINDLLVGEFKIAKEKETAA 116 SMF KQWFRP+EASNLR + +LLV EFK AKEKE+ + Sbjct: 488 SMFSKQWFRPQEASNLRAKVCELLVEEFKKAKEKESTS 525