BLASTX nr result
ID: Chrysanthemum22_contig00041989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041989 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY84188.1| hypothetical protein LSAT_3X95661 [Lactuca sativa] 44 1e-07 >gb|PLY84188.1| hypothetical protein LSAT_3X95661 [Lactuca sativa] Length = 93 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 179 NDFDVENGKIEKIQDTG--SLKIVVIMAGDNVPTYMANPVVLN 301 +D DVE+GK D S KIVVIMAGD +PTY+A P +N Sbjct: 51 SDQDVESGKAVMFHDEAYSSPKIVVIMAGDEIPTYLATPAGVN 93 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +3 Query: 57 FWRFDSPLIYLFTGXXXXXXXXXXXXXXXXCSQRNRR 167 FWRFDSPL+YLF G CSQR+RR Sbjct: 10 FWRFDSPLVYLFGGIAAMLALIVVALVILACSQRHRR 46