BLASTX nr result
ID: Chrysanthemum22_contig00041792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041792 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022001037.1| uncharacterized protein LOC110898553 [Helian... 80 2e-15 gb|PLY72676.1| hypothetical protein LSAT_6X21220 [Lactuca sativa] 68 8e-11 ref|XP_023735268.1| uncharacterized protein LOC111883142 [Lactuc... 68 9e-11 ref|XP_008443963.1| PREDICTED: U11/U12 small nuclear ribonucleop... 56 3e-07 ref|XP_022144848.1| U11/U12 small nuclear ribonucleoprotein 25 k... 55 4e-07 ref|XP_011655436.1| PREDICTED: U11/U12 small nuclear ribonucleop... 55 6e-07 ref|XP_008443964.1| PREDICTED: U11/U12 small nuclear ribonucleop... 55 6e-07 gb|PNX78004.1| U11/U12 small nuclear ribonucleoprotein 25 kDa pr... 54 2e-06 gb|KJB27347.1| hypothetical protein B456_004G292300 [Gossypium r... 54 5e-06 gb|OUZ99866.1| hypothetical protein BVC80_9067g52 [Macleaya cord... 54 6e-06 gb|KHG21279.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [G... 54 7e-06 ref|XP_017625480.1| PREDICTED: uncharacterized protein LOC108469... 54 8e-06 ref|XP_016728967.1| PREDICTED: uncharacterized protein LOC107940... 54 8e-06 ref|XP_016738819.1| PREDICTED: uncharacterized protein LOC107948... 54 8e-06 ref|XP_012477373.1| PREDICTED: uncharacterized protein LOC105793... 54 8e-06 dbj|GAU15090.1| hypothetical protein TSUD_08280 [Trifolium subte... 52 8e-06 >ref|XP_022001037.1| uncharacterized protein LOC110898553 [Helianthus annuus] gb|OTG01527.1| putative ubiquitin-related domain-containing protein [Helianthus annuus] Length = 274 Score = 80.1 bits (196), Expect = 2e-15 Identities = 42/76 (55%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = +3 Query: 153 RADC-ICRPHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQVSVCN*IVL*LAYLIFY*Q 329 + DC I PHVWGNFCLCFEHMKLLRDRDPI R+GIK+GD Sbjct: 101 QGDCWISWPHVWGNFCLCFEHMKLLRDRDPIARYGIKNGD-------------------- 140 Query: 330 VYVSILQLQFVRHTPI 377 QLQFVRHTPI Sbjct: 141 ------QLQFVRHTPI 150 >gb|PLY72676.1| hypothetical protein LSAT_6X21220 [Lactuca sativa] Length = 284 Score = 67.8 bits (164), Expect = 8e-11 Identities = 35/67 (52%), Positives = 38/67 (56%) Frame = +3 Query: 177 HVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQVSVCN*IVL*LAYLIFY*QVYVSILQLQ 356 HVWG+FCLCFE MKL RDRD ITRFGIK+GD QLQ Sbjct: 113 HVWGHFCLCFESMKLFRDRDSITRFGIKNGD--------------------------QLQ 146 Query: 357 FVRHTPI 377 FVRHTP+ Sbjct: 147 FVRHTPM 153 >ref|XP_023735268.1| uncharacterized protein LOC111883142 [Lactuca sativa] Length = 297 Score = 67.8 bits (164), Expect = 9e-11 Identities = 35/67 (52%), Positives = 38/67 (56%) Frame = +3 Query: 177 HVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQVSVCN*IVL*LAYLIFY*QVYVSILQLQ 356 HVWG+FCLCFE MKL RDRD ITRFGIK+GD QLQ Sbjct: 113 HVWGHFCLCFESMKLFRDRDSITRFGIKNGD--------------------------QLQ 146 Query: 357 FVRHTPI 377 FVRHTP+ Sbjct: 147 FVRHTPM 153 >ref|XP_008443963.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like isoform X1 [Cucumis melo] Length = 147 Score = 56.2 bits (134), Expect = 3e-07 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++H KL+ D+ I FGI+ GDQV Sbjct: 88 PHVWGHFCLCYKHFKLMDDKSRIQHFGIRDGDQV 121 >ref|XP_022144848.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Momordica charantia] ref|XP_022144849.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Momordica charantia] Length = 128 Score = 55.5 bits (132), Expect = 4e-07 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQVSVCN 287 PHVWG+FCLC++H KL+ D+ I FGI+ G+Q+ N Sbjct: 88 PHVWGHFCLCYKHFKLINDKSHIKHFGIRDGEQLHFVN 125 >ref|XP_011655436.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Cucumis sativus] gb|KGN65130.1| hypothetical protein Csa_1G231020 [Cucumis sativus] Length = 129 Score = 55.1 bits (131), Expect = 6e-07 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++H KL+ D+ I FGI+ GDQ+ Sbjct: 85 PHVWGHFCLCYKHFKLMDDKSRIQHFGIRDGDQL 118 >ref|XP_008443964.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like isoform X2 [Cucumis melo] Length = 132 Score = 55.1 bits (131), Expect = 6e-07 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++H KL+ D+ I FGI+ GDQ+ Sbjct: 88 PHVWGHFCLCYKHFKLMDDKSRIQHFGIRDGDQL 121 >gb|PNX78004.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein, partial [Trifolium pratense] Length = 171 Score = 54.3 bits (129), Expect = 2e-06 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = +3 Query: 171 RPHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQVS 278 RPHVWG FCLC++ MKL+ + D + +G+K GDQ++ Sbjct: 1 RPHVWGQFCLCYDGMKLVTEEDHLRNYGVKDGDQLN 36 >gb|KJB27347.1| hypothetical protein B456_004G292300 [Gossypium raimondii] Length = 210 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 45 PHVWGHFCLCYDGQKLLTDTDHIMNYGIKDGDQL 78 >gb|OUZ99866.1| hypothetical protein BVC80_9067g52 [Macleaya cordata] Length = 231 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +3 Query: 177 HVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 HVWG+FCLCFE KLL D+ I FGIK GDQ+ Sbjct: 74 HVWGHFCLCFESQKLLNDKANIRSFGIKDGDQI 106 >gb|KHG21279.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [Gossypium arboreum] Length = 249 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 84 PHVWGHFCLCYDGQKLLTDTDHIMNYGIKDGDQL 117 >ref|XP_017625480.1| PREDICTED: uncharacterized protein LOC108469105 [Gossypium arboreum] Length = 275 Score = 53.9 bits (128), Expect = 8e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 110 PHVWGHFCLCYDGQKLLTDTDHIMNYGIKDGDQL 143 >ref|XP_016728967.1| PREDICTED: uncharacterized protein LOC107940068 [Gossypium hirsutum] Length = 275 Score = 53.9 bits (128), Expect = 8e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 110 PHVWGHFCLCYDGQKLLTDTDHIINYGIKDGDQL 143 >ref|XP_016738819.1| PREDICTED: uncharacterized protein LOC107948701 [Gossypium hirsutum] gb|PPR83416.1| hypothetical protein GOBAR_AA37294 [Gossypium barbadense] Length = 275 Score = 53.9 bits (128), Expect = 8e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 110 PHVWGHFCLCYDGQKLLTDTDHIMNYGIKDGDQL 143 >ref|XP_012477373.1| PREDICTED: uncharacterized protein LOC105793011 isoform X1 [Gossypium raimondii] ref|XP_012477374.1| PREDICTED: uncharacterized protein LOC105793011 isoform X1 [Gossypium raimondii] ref|XP_012477375.1| PREDICTED: uncharacterized protein LOC105793011 isoform X1 [Gossypium raimondii] gb|KJB27346.1| hypothetical protein B456_004G292300 [Gossypium raimondii] Length = 275 Score = 53.9 bits (128), Expect = 8e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 174 PHVWGNFCLCFEHMKLLRDRDPITRFGIKSGDQV 275 PHVWG+FCLC++ KLL D D I +GIK GDQ+ Sbjct: 110 PHVWGHFCLCYDGQKLLTDTDHIMNYGIKDGDQL 143 >dbj|GAU15090.1| hypothetical protein TSUD_08280 [Trifolium subterraneum] Length = 125 Score = 52.0 bits (123), Expect = 8e-06 Identities = 25/62 (40%), Positives = 35/62 (56%) Frame = +3 Query: 90 TNTIFLDKNIHYSVGKLSPLYRADCICRPHVWGNFCLCFEHMKLLRDRDPITRFGIKSGD 269 T TI K+ +V P + I PHVWG FCLC++ KL+ + D + +G+K GD Sbjct: 64 TATIAELKDAVEAVFSYMPQHGPGKISWPHVWGQFCLCYDGRKLVTEEDHLRNYGVKDGD 123 Query: 270 QV 275 QV Sbjct: 124 QV 125