BLASTX nr result
ID: Chrysanthemum22_contig00041433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041433 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989727.1| armadillo repeat-containing protein 7 [Helia... 72 1e-12 gb|OTG12464.1| putative armadillo-type fold, Ubiquitin-related d... 72 5e-12 ref|XP_009357804.1| PREDICTED: armadillo repeat-containing prote... 67 8e-11 ref|XP_012075575.1| armadillo repeat-containing protein 7 isofor... 66 9e-11 emb|CDP01689.1| unnamed protein product [Coffea canephora] 66 1e-10 ref|XP_012075572.1| armadillo repeat-containing protein 7 isofor... 66 2e-10 ref|XP_019182748.1| PREDICTED: armadillo repeat-containing prote... 64 6e-10 ref|XP_008348587.1| PREDICTED: armadillo repeat-containing prote... 64 9e-10 ref|XP_023732782.1| armadillo repeat-containing protein 7 [Lactu... 63 2e-09 ref|XP_010648899.1| PREDICTED: armadillo repeat-containing prote... 63 2e-09 ref|XP_002270403.1| PREDICTED: armadillo repeat-containing prote... 63 2e-09 ref|XP_022879726.1| armadillo repeat-containing protein 7-like i... 63 2e-09 ref|XP_022879722.1| armadillo repeat-containing protein 7-like i... 63 2e-09 ref|XP_022879721.1| armadillo repeat-containing protein 7-like i... 63 4e-09 ref|XP_022879720.1| armadillo repeat-containing protein 7-like i... 63 4e-09 gb|KVH88220.1| Armadillo [Cynara cardunculus var. scolymus] 62 4e-09 ref|XP_004301610.1| PREDICTED: armadillo repeat-containing prote... 62 5e-09 gb|OVA02589.1| Armadillo [Macleaya cordata] 62 6e-09 ref|XP_011077040.1| armadillo repeat-containing protein 7 [Sesam... 62 6e-09 gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pr... 59 8e-09 >ref|XP_021989727.1| armadillo repeat-containing protein 7 [Helianthus annuus] ref|XP_021989728.1| armadillo repeat-containing protein 7 [Helianthus annuus] Length = 178 Score = 71.6 bits (174), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSENH 317 RPEVVDI+KRYAAAG+VSVSFSNLAQAFLDKHV ENH Sbjct: 142 RPEVVDIIKRYAAAGSVSVSFSNLAQAFLDKHVPENH 178 >gb|OTG12464.1| putative armadillo-type fold, Ubiquitin-related domain protein [Helianthus annuus] Length = 303 Score = 71.6 bits (174), Expect = 5e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSENH 317 RPEVVDI+KRYAAAG+VSVSFSNLAQAFLDKHV ENH Sbjct: 267 RPEVVDIIKRYAAAGSVSVSFSNLAQAFLDKHVPENH 303 >ref|XP_009357804.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_009357805.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503296.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503297.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503299.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] Length = 183 Score = 66.6 bits (161), Expect = 8e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 +PEVVD++KRYAAAGAV+VSFSNLA+AFLDKHVSEN Sbjct: 143 KPEVVDVMKRYAAAGAVNVSFSNLAKAFLDKHVSEN 178 >ref|XP_012075575.1| armadillo repeat-containing protein 7 isoform X2 [Jatropha curcas] gb|KDP34905.1| hypothetical protein JCGZ_09193 [Jatropha curcas] Length = 150 Score = 65.9 bits (159), Expect = 9e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 +PEV+DI++RYAAAGAVSVSFSNLA+AFLDKHVS+N Sbjct: 109 KPEVIDIIQRYAAAGAVSVSFSNLAKAFLDKHVSDN 144 >emb|CDP01689.1| unnamed protein product [Coffea canephora] Length = 182 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVDI+KRYA+AGAVSVSFSN+AQAFLDKHVSE Sbjct: 142 KPEVVDIIKRYASAGAVSVSFSNIAQAFLDKHVSE 176 >ref|XP_012075572.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_012075573.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_020536090.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_020536091.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] Length = 183 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 +PEV+DI++RYAAAGAVSVSFSNLA+AFLDKHVS+N Sbjct: 142 KPEVIDIIQRYAAAGAVSVSFSNLAKAFLDKHVSDN 177 >ref|XP_019182748.1| PREDICTED: armadillo repeat-containing protein 7 [Ipomoea nil] ref|XP_019182749.1| PREDICTED: armadillo repeat-containing protein 7 [Ipomoea nil] Length = 179 Score = 64.3 bits (155), Expect = 6e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVD++KRYAAAG VSVSFSNLAQAFLDKH+S+ Sbjct: 143 KPEVVDVIKRYAAAGEVSVSFSNLAQAFLDKHISD 177 >ref|XP_008348587.1| PREDICTED: armadillo repeat-containing protein 7-like [Malus domestica] ref|XP_017181368.1| PREDICTED: armadillo repeat-containing protein 7-like [Malus domestica] Length = 183 Score = 63.9 bits (154), Expect = 9e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSENH 317 +PEVVD++KRYAAA AV+VSFSNLA+AFLDKHVSEN+ Sbjct: 143 KPEVVDVMKRYAAAEAVNVSFSNLAKAFLDKHVSENN 179 >ref|XP_023732782.1| armadillo repeat-containing protein 7 [Lactuca sativa] ref|XP_023732783.1| armadillo repeat-containing protein 7 [Lactuca sativa] gb|PLY74673.1| hypothetical protein LSAT_5X79100 [Lactuca sativa] Length = 178 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSENH 317 RPEVVD++KRYAAA V VSF+NLAQAFLDKHV E H Sbjct: 142 RPEVVDVIKRYAAADGVGVSFTNLAQAFLDKHVPEKH 178 >ref|XP_010648899.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Vitis vinifera] Length = 175 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/35 (80%), Positives = 35/35 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 RPEVVD++K+YAAAG+VSV+FSNLA+AFLDKHVS+ Sbjct: 140 RPEVVDVIKKYAAAGSVSVNFSNLAKAFLDKHVSQ 174 >ref|XP_002270403.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Vitis vinifera] ref|XP_010648898.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Vitis vinifera] emb|CBI27351.3| unnamed protein product, partial [Vitis vinifera] Length = 177 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/35 (80%), Positives = 35/35 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 RPEVVD++K+YAAAG+VSV+FSNLA+AFLDKHVS+ Sbjct: 142 RPEVVDVIKKYAAAGSVSVNFSNLAKAFLDKHVSQ 176 >ref|XP_022879726.1| armadillo repeat-containing protein 7-like isoform X4 [Olea europaea var. sylvestris] Length = 178 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVD++KRYAA+GA+S SFSNLA AFLDKHVSE Sbjct: 142 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 176 >ref|XP_022879722.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] ref|XP_022879724.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] ref|XP_022879725.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] Length = 179 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVD++KRYAA+GA+S SFSNLA AFLDKHVSE Sbjct: 143 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 177 >ref|XP_022879721.1| armadillo repeat-containing protein 7-like isoform X2 [Olea europaea var. sylvestris] Length = 208 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVD++KRYAA+GA+S SFSNLA AFLDKHVSE Sbjct: 172 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 206 >ref|XP_022879720.1| armadillo repeat-containing protein 7-like isoform X1 [Olea europaea var. sylvestris] Length = 209 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 +PEVVD++KRYAA+GA+S SFSNLA AFLDKHVSE Sbjct: 173 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 207 >gb|KVH88220.1| Armadillo [Cynara cardunculus var. scolymus] Length = 178 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 RPEVV+I++RYAAAG VS+SFSNLA++FLDKHV EN Sbjct: 142 RPEVVNIIRRYAAAGGVSISFSNLARSFLDKHVPEN 177 >ref|XP_004301610.1| PREDICTED: armadillo repeat-containing protein 7-like [Fragaria vesca subsp. vesca] Length = 186 Score = 62.0 bits (149), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 +PEVVDI+KRYAAA SVSFSNLA+AFLDKHVSEN Sbjct: 149 KPEVVDIMKRYAAAEGASVSFSNLAKAFLDKHVSEN 184 >gb|OVA02589.1| Armadillo [Macleaya cordata] Length = 178 Score = 61.6 bits (148), Expect = 6e-09 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVS 326 RPEV+++++RYAAAGAVSVSFSNLA+AFLDKH+S Sbjct: 142 RPEVIEVIERYAAAGAVSVSFSNLAKAFLDKHIS 175 >ref|XP_011077040.1| armadillo repeat-containing protein 7 [Sesamum indicum] Length = 178 Score = 61.6 bits (148), Expect = 6e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSE 323 RPE+VD +KR+A+AGAV+V FSNLAQAFLDKHVSE Sbjct: 142 RPEIVDAIKRFASAGAVNVGFSNLAQAFLDKHVSE 176 >gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pratense] Length = 94 Score = 59.3 bits (142), Expect = 8e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 427 RPEVVDIVKRYAAAGAVSVSFSNLAQAFLDKHVSEN 320 +PEV+D++KRYAAA VSVSFSNLA+AFLDKH+S N Sbjct: 59 KPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSGN 94