BLASTX nr result
ID: Chrysanthemum22_contig00041426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041426 (744 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023769005.1| patellin-6-like isoform X1 [Lactuca sativa] ... 60 7e-07 >ref|XP_023769005.1| patellin-6-like isoform X1 [Lactuca sativa] ref|XP_023769006.1| patellin-6-like isoform X2 [Lactuca sativa] Length = 407 Score = 59.7 bits (143), Expect(2) = 7e-07 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = -2 Query: 629 GGWRV--G*HFVPDDVARLAMLLENPKNMEVTDLPLRRHYIAKEPGKLVLSINNKAS*KT 456 GGW + FVP+DV + +E + M VTD + + AKE GKL+LSINN AS K Sbjct: 334 GGWDLEYSAEFVPNDVGSYTIAVEKTRKMTVTDKAVHNSFTAKEAGKLILSINNTASSKR 393 Query: 455 KFVA*RYQMQES 420 K A RY +Q+S Sbjct: 394 KVAAYRYLVQKS 405 Score = 22.3 bits (46), Expect(2) = 7e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 643 ITGDVVVGGWD 611 I D+VVGGWD Sbjct: 327 IAWDLVVGGWD 337