BLASTX nr result
ID: Chrysanthemum22_contig00041236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041236 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93617.1| XS domain-containing protein [Cynara cardunculus ... 60 5e-08 ref|XP_021996933.1| protein SUPPRESSOR OF GENE SILENCING 3 [Heli... 54 1e-05 gb|OTG04142.1| putative ribonuclease P [Helianthus annuus] 54 1e-05 >gb|KVH93617.1| XS domain-containing protein [Cynara cardunculus var. scolymus] Length = 621 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 358 LHEEKMAEMKSRHWRELLAMEAGHNTELSQLRAKYTPKYAVQG 230 LHEEK AEMK RHWRE + +E G N ELS+L KYT K+ VQG Sbjct: 579 LHEEKTAEMKGRHWREEIELEEGLNAELSRLMDKYTSKHEVQG 621 >ref|XP_021996933.1| protein SUPPRESSOR OF GENE SILENCING 3 [Helianthus annuus] ref|XP_021996934.1| protein SUPPRESSOR OF GENE SILENCING 3 [Helianthus annuus] ref|XP_021996935.1| protein SUPPRESSOR OF GENE SILENCING 3 [Helianthus annuus] ref|XP_021996936.1| protein SUPPRESSOR OF GENE SILENCING 3 [Helianthus annuus] Length = 585 Score = 53.5 bits (127), Expect = 1e-05 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 355 HEEKMAEMKSRHWRELLAMEAGHNTELSQLRAKYTPK 245 HEEK+AEMKSRHW+E L +E G + EL+QL +KY P+ Sbjct: 548 HEEKIAEMKSRHWKEQLEIENGFDAELAQLMSKYIPE 584 >gb|OTG04142.1| putative ribonuclease P [Helianthus annuus] Length = 617 Score = 53.5 bits (127), Expect = 1e-05 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 355 HEEKMAEMKSRHWRELLAMEAGHNTELSQLRAKYTPK 245 HEEK+AEMKSRHW+E L +E G + EL+QL +KY P+ Sbjct: 580 HEEKIAEMKSRHWKEQLEIENGFDAELAQLMSKYIPE 616