BLASTX nr result
ID: Chrysanthemum22_contig00041229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041229 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022002052.1| kinesin-like protein KIN-7C [Helianthus annu... 96 2e-20 gb|KVI08791.1| Kinesin, motor domain-containing protein [Cynara ... 93 2e-19 ref|XP_023764838.1| kinesin-like protein KIN-7G [Lactuca sativa]... 77 5e-14 >ref|XP_022002052.1| kinesin-like protein KIN-7C [Helianthus annuus] gb|OTG02581.1| putative kinesin motor domain-containing protein [Helianthus annuus] Length = 931 Score = 95.9 bits (237), Expect = 2e-20 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -1 Query: 377 DSCHDWDDDVDEKSNGTSHELCKVVRCIEAEDLIPKAYVDESYCSSPDTKIRVSSQAV 204 DSCHDW+D VDEKSNG+ HELCKVVRCIE+E++ PKAYV SYCSSPDTK+RVSS+ V Sbjct: 522 DSCHDWND-VDEKSNGSFHELCKVVRCIESEEITPKAYV-RSYCSSPDTKVRVSSETV 577 >gb|KVI08791.1| Kinesin, motor domain-containing protein [Cynara cardunculus var. scolymus] Length = 998 Score = 92.8 bits (229), Expect = 2e-19 Identities = 50/91 (54%), Positives = 61/91 (67%) Frame = -1 Query: 374 SCHDWDDDVDEKSNGTSHELCKVVRCIEAEDLIPKAYVDESYCSSPDTKIRVSSQAVFXX 195 SCH+WD+ VDEKSN TS ELCK V CIE E+L PK YV +SYC SPD IR+SSQA+F Sbjct: 551 SCHEWDE-VDEKSNRTSQELCKEVCCIETEELTPKIYV-QSYCLSPDANIRISSQAMF-- 606 Query: 194 XXXXXXXXXXHSKNSEVLNSKGEYMAPKMVE 102 S+ +V ++KGEYM+PK E Sbjct: 607 -------HDDESETHDVTSTKGEYMSPKSNE 630 >ref|XP_023764838.1| kinesin-like protein KIN-7G [Lactuca sativa] gb|PLY84695.1| hypothetical protein LSAT_2X78600 [Lactuca sativa] Length = 961 Score = 77.4 bits (189), Expect = 5e-14 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 5/103 (4%) Frame = -1 Query: 377 DSCHDWDDDVDEKSNGTSHELCKVVRCIEAEDLIPKAYVDESYCSSPDTKIRVSSQAVFX 198 +SC DWD+ VD+KSN T LCKVVRCIE ED I +SYCSSPD KIR+ + F Sbjct: 525 ESCLDWDE-VDDKSNATPQVLCKVVRCIEREDSIQNV---DSYCSSPDVKIRIPNHETFH 580 Query: 197 XXXXXXXXXXXHSKNSEVLNSKGEYMAP-----KMVEATLKED 84 ++ EV++SK EYM+P ++ ++ L ED Sbjct: 581 DDQSEI-------ESHEVISSKPEYMSPNSNADRITQSPLNED 616