BLASTX nr result
ID: Chrysanthemum22_contig00041165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00041165 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGM15310.1| embryonic flower 1 [Chrysanthemum x morifolium] 60 2e-07 >gb|AGM15310.1| embryonic flower 1 [Chrysanthemum x morifolium] Length = 1044 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/47 (68%), Positives = 32/47 (68%) Frame = -1 Query: 525 FTTPGAENIYMINPDDLXXXXXXXXXXXXXXXVNELKRQKKVLKPAS 385 FTTPGAENIYMINPDDL VNELKRQKKVLKPAS Sbjct: 998 FTTPGAENIYMINPDDLVAKGKSSSKVKASVSVNELKRQKKVLKPAS 1044