BLASTX nr result
ID: Chrysanthemum22_contig00040873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040873 (881 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP77875.1| hypothetical protein KK1_047485 [Cajanus cajan] 59 1e-07 >gb|KYP77875.1| hypothetical protein KK1_047485 [Cajanus cajan] Length = 102 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 768 GRVEPREALFRGRSLAPLHFLQGSKPFFNISDKE 869 GRVEPREAL RGRSLAP H LQGSKPFFNI K+ Sbjct: 9 GRVEPREALLRGRSLAPPHSLQGSKPFFNIGSKK 42