BLASTX nr result
ID: Chrysanthemum22_contig00040840
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040840 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR45475.1| hypothetical protein CICLE_v10000018mg [Citrus cl... 58 5e-07 dbj|GAY56883.1| hypothetical protein CUMW_175300 [Citrus unshiu] 58 5e-07 dbj|GAY56882.1| hypothetical protein CUMW_175300 [Citrus unshiu] 58 5e-07 ref|XP_015383388.1| PREDICTED: callose synthase 5 [Citrus sinensis] 58 5e-07 ref|XP_024038938.1| LOW QUALITY PROTEIN: callose synthase 5 [Cit... 58 5e-07 ref|XP_008342870.1| PREDICTED: callose synthase 5-like [Malus do... 57 9e-07 gb|OVA15866.1| Glycosyl transferase [Macleaya cordata] 57 9e-07 gb|PLY85868.1| hypothetical protein LSAT_8X116700 [Lactuca sativa] 57 1e-06 ref|XP_023763287.1| callose synthase 5 [Lactuca sativa] 57 1e-06 ref|XP_021630454.1| callose synthase 5 [Manihot esculenta] 56 2e-06 gb|OAY36091.1| hypothetical protein MANES_12G155300 [Manihot esc... 56 2e-06 ref|XP_016437517.1| PREDICTED: callose synthase 5-like, partial ... 55 2e-06 gb|KDO58320.1| hypothetical protein CISIN_1g0457373mg, partial [... 55 4e-06 gb|PHT31778.1| Callose synthase 3 [Capsicum baccatum] 55 4e-06 gb|POE85794.1| callose synthase 5 [Quercus suber] 55 4e-06 ref|XP_023872478.1| callose synthase 5 [Quercus suber] 55 4e-06 ref|XP_016551204.1| PREDICTED: callose synthase 5 [Capsicum annuum] 55 4e-06 ref|XP_019253275.1| PREDICTED: callose synthase 5 [Nicotiana att... 55 4e-06 ref|XP_016435564.1| PREDICTED: callose synthase 5 [Nicotiana tab... 55 4e-06 ref|XP_015057067.1| PREDICTED: callose synthase 5 [Solanum penne... 55 4e-06 >gb|ESR45475.1| hypothetical protein CICLE_v10000018mg [Citrus clementina] Length = 1715 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + T+ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 965 SETEILEGYKAITIPSEEEKKSQRSLYAQLEAV 997 >dbj|GAY56883.1| hypothetical protein CUMW_175300 [Citrus unshiu] Length = 1870 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + T+ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 1254 SETEILEGYKAITIPSEEEKKSQRSLYAQLEAV 1286 >dbj|GAY56882.1| hypothetical protein CUMW_175300 [Citrus unshiu] Length = 1892 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + T+ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 1254 SETEILEGYKAITIPSEEEKKSQRSLYAQLEAV 1286 >ref|XP_015383388.1| PREDICTED: callose synthase 5 [Citrus sinensis] Length = 1917 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + T+ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 1167 SETEILEGYKAITIPSEEEKKSQRSLYAQLEAV 1199 >ref|XP_024038938.1| LOW QUALITY PROTEIN: callose synthase 5 [Citrus clementina] Length = 1960 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + T+ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 1199 SETEILEGYKAITIPSEEEKKSQRSLYAQLEAV 1231 >ref|XP_008342870.1| PREDICTED: callose synthase 5-like [Malus domestica] ref|XP_008342871.1| PREDICTED: callose synthase 5-like [Malus domestica] Length = 1922 Score = 57.0 bits (136), Expect = 9e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 N T+IL+GYKA+TVP EEEKKSQ+SLYAQLEA+ Sbjct: 1173 NETEILDGYKAITVPPEEEKKSQRSLYAQLEAV 1205 >gb|OVA15866.1| Glycosyl transferase [Macleaya cordata] Length = 1936 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +2 Query: 293 NHTKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 + ++ILEGYKAVTVPSEEEKKSQ+SLYAQLEA+ Sbjct: 1191 SESEILEGYKAVTVPSEEEKKSQRSLYAQLEAV 1223 >gb|PLY85868.1| hypothetical protein LSAT_8X116700 [Lactuca sativa] Length = 1072 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKA+T+PSEE+KKSQKSLYAQLEAL Sbjct: 347 EILEGYKAITIPSEEDKKSQKSLYAQLEAL 376 >ref|XP_023763287.1| callose synthase 5 [Lactuca sativa] Length = 1718 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKA+T+PSEE+KKSQKSLYAQLEAL Sbjct: 976 EILEGYKAITIPSEEDKKSQKSLYAQLEAL 1005 >ref|XP_021630454.1| callose synthase 5 [Manihot esculenta] Length = 1719 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +2 Query: 299 TKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 T+ILEGYKA+T+PSEE+KKSQ+SLYAQLEA+ Sbjct: 971 TEILEGYKAITIPSEEDKKSQRSLYAQLEAV 1001 >gb|OAY36091.1| hypothetical protein MANES_12G155300 [Manihot esculenta] Length = 1859 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +2 Query: 299 TKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 T+ILEGYKA+T+PSEE+KKSQ+SLYAQLEA+ Sbjct: 1111 TEILEGYKAITIPSEEDKKSQRSLYAQLEAV 1141 >ref|XP_016437517.1| PREDICTED: callose synthase 5-like, partial [Nicotiana tabacum] Length = 207 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 107 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 136 >gb|KDO58320.1| hypothetical protein CISIN_1g0457373mg, partial [Citrus sinensis] Length = 512 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +2 Query: 305 ILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 ILEGYKA+T+PSEEEKKSQ+SLYAQLEA+ Sbjct: 1 ILEGYKAITIPSEEEKKSQRSLYAQLEAV 29 >gb|PHT31778.1| Callose synthase 3 [Capsicum baccatum] Length = 1117 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 375 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 404 >gb|POE85794.1| callose synthase 5 [Quercus suber] Length = 1771 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +2 Query: 299 TKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 ++ILEGYKAVT+PSEE+KKSQ+SLYAQLEA+ Sbjct: 1029 SEILEGYKAVTIPSEEDKKSQRSLYAQLEAV 1059 >ref|XP_023872478.1| callose synthase 5 [Quercus suber] Length = 1824 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +2 Query: 299 TKILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 ++ILEGYKAVT+PSEE+KKSQ+SLYAQLEA+ Sbjct: 1082 SEILEGYKAVTIPSEEDKKSQRSLYAQLEAV 1112 >ref|XP_016551204.1| PREDICTED: callose synthase 5 [Capsicum annuum] Length = 1927 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 1185 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 1214 >ref|XP_019253275.1| PREDICTED: callose synthase 5 [Nicotiana attenuata] ref|XP_019253276.1| PREDICTED: callose synthase 5 [Nicotiana attenuata] Length = 1931 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 1189 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 1218 >ref|XP_016435564.1| PREDICTED: callose synthase 5 [Nicotiana tabacum] Length = 1931 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 1189 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 1218 >ref|XP_015057067.1| PREDICTED: callose synthase 5 [Solanum pennellii] Length = 1931 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 302 KILEGYKAVTVPSEEEKKSQKSLYAQLEAL 391 +ILEGYKAVTVPSEE+KKSQ+SLYAQLEA+ Sbjct: 1189 EILEGYKAVTVPSEEDKKSQRSLYAQLEAV 1218