BLASTX nr result
ID: Chrysanthemum22_contig00040569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040569 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAX18336.1| dicel-like 1, partial [Nicotiana benthamiana] 67 3e-12 ref|XP_017257896.1| PREDICTED: endoribonuclease Dicer homolog 1 ... 72 5e-12 gb|KZM90516.1| hypothetical protein DCAR_022119 [Daucus carota s... 72 5e-12 gb|KVH91073.1| hypothetical protein Ccrd_006913, partial [Cynara... 72 6e-12 ref|XP_011071729.1| endoribonuclease Dicer homolog 1 [Sesamum in... 72 6e-12 gb|KZV56513.1| endoribonuclease Dicer1 [Dorcoceras hygrometricum] 72 8e-12 gb|POE94878.1| endoribonuclease dicer like 1 [Quercus suber] 71 1e-11 ref|XP_023925249.1| endoribonuclease Dicer homolog 1 [Quercus su... 71 1e-11 gb|EYU35897.1| hypothetical protein MIMGU_mgv1a000073mg [Erythra... 71 2e-11 ref|XP_012839417.1| PREDICTED: endoribonuclease Dicer homolog 1 ... 71 2e-11 ref|XP_022148518.1| endoribonuclease Dicer homolog 1 [Momordica ... 71 2e-11 ref|XP_011650612.1| PREDICTED: endoribonuclease Dicer homolog 1 ... 71 2e-11 ref|XP_008437750.1| PREDICTED: endoribonuclease Dicer homolog 1 ... 71 2e-11 ref|XP_018832219.1| PREDICTED: endoribonuclease Dicer homolog 1-... 70 2e-11 ref|XP_022859704.1| endoribonuclease Dicer homolog 1 [Olea europ... 70 2e-11 gb|OTG38556.1| putative dicer-like 1 [Helianthus annuus] 70 3e-11 ref|XP_021987907.1| LOW QUALITY PROTEIN: endoribonuclease Dicer ... 70 3e-11 ref|XP_023753673.1| endoribonuclease Dicer homolog 1 [Lactuca sa... 70 3e-11 gb|PLY93172.1| hypothetical protein LSAT_3X140760 [Lactuca sativa] 70 3e-11 ref|XP_018840835.1| PREDICTED: endoribonuclease Dicer homolog 1 ... 70 4e-11 >emb|CAX18336.1| dicel-like 1, partial [Nicotiana benthamiana] Length = 79 Score = 67.4 bits (163), Expect = 3e-12 Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KH LH+HLR GSSALEKQIRDFV +V+NEL Sbjct: 20 DLPPGRLTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFVSEVKNEL 74 >ref|XP_017257896.1| PREDICTED: endoribonuclease Dicer homolog 1 [Daucus carota subsp. sativus] Length = 1964 Score = 72.4 bits (176), Expect = 5e-12 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 10/58 (17%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL*SQ 189 DLPPG DLRAAAV KHNLHVHLR GS+ALEKQIRDFVK+V+NEL Q Sbjct: 1685 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSNALEKQIRDFVKEVQNELLKQ 1742 >gb|KZM90516.1| hypothetical protein DCAR_022119 [Daucus carota subsp. sativus] Length = 1986 Score = 72.4 bits (176), Expect = 5e-12 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 10/58 (17%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL*SQ 189 DLPPG DLRAAAV KHNLHVHLR GS+ALEKQIRDFVK+V+NEL Q Sbjct: 1707 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSNALEKQIRDFVKEVQNELLKQ 1764 >gb|KVH91073.1| hypothetical protein Ccrd_006913, partial [Cynara cardunculus var. scolymus] Length = 1908 Score = 72.0 bits (175), Expect = 6e-12 Identities = 39/55 (70%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLHVHLR GSSALEKQIRDFVK+VE EL Sbjct: 1632 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIRDFVKEVEGEL 1686 >ref|XP_011071729.1| endoribonuclease Dicer homolog 1 [Sesamum indicum] Length = 1934 Score = 72.0 bits (175), Expect = 6e-12 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+V+NEL Sbjct: 1654 DLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQNEL 1708 >gb|KZV56513.1| endoribonuclease Dicer1 [Dorcoceras hygrometricum] Length = 1936 Score = 71.6 bits (174), Expect = 8e-12 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH HLR GSSALEKQIRDFVK+V+NEL Sbjct: 1327 DLPPGRLTDLRAAAVNNENFARVAVKHNLHTHLRHGSSALEKQIRDFVKEVQNEL 1381 >gb|POE94878.1| endoribonuclease dicer like 1 [Quercus suber] Length = 1948 Score = 71.2 bits (173), Expect = 1e-11 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLHVHLR GSSALEKQIRDFVK+V++EL Sbjct: 1668 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIRDFVKEVQDEL 1722 >ref|XP_023925249.1| endoribonuclease Dicer homolog 1 [Quercus suber] Length = 1981 Score = 71.2 bits (173), Expect = 1e-11 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLHVHLR GSSALEKQIRDFVK+V++EL Sbjct: 1701 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIRDFVKEVQDEL 1755 >gb|EYU35897.1| hypothetical protein MIMGU_mgv1a000073mg [Erythranthe guttata] Length = 1905 Score = 70.9 bits (172), Expect = 2e-11 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH HLR GSSALEKQIRDFVK+VE+EL Sbjct: 1624 DLPPGRLTDLRAAAVNNENFARVSVKHNLHTHLRHGSSALEKQIRDFVKEVESEL 1678 >ref|XP_012839417.1| PREDICTED: endoribonuclease Dicer homolog 1 [Erythranthe guttata] Length = 1919 Score = 70.9 bits (172), Expect = 2e-11 Identities = 38/55 (69%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH HLR GSSALEKQIRDFVK+VE+EL Sbjct: 1638 DLPPGRLTDLRAAAVNNENFARVSVKHNLHTHLRHGSSALEKQIRDFVKEVESEL 1692 >ref|XP_022148518.1| endoribonuclease Dicer homolog 1 [Momordica charantia] Length = 1987 Score = 70.9 bits (172), Expect = 2e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+V++EL Sbjct: 1707 DLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQDEL 1761 >ref|XP_011650612.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis sativus] gb|KGN56328.1| hypothetical protein Csa_3G116650 [Cucumis sativus] Length = 1989 Score = 70.9 bits (172), Expect = 2e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+V++EL Sbjct: 1709 DLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQDEL 1763 >ref|XP_008437750.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis melo] Length = 1990 Score = 70.9 bits (172), Expect = 2e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+V++EL Sbjct: 1710 DLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQDEL 1764 >ref|XP_018832219.1| PREDICTED: endoribonuclease Dicer homolog 1-like, partial [Juglans regia] Length = 282 Score = 69.7 bits (169), Expect = 2e-11 Identities = 37/55 (67%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLHVHLR GSSALEKQIRDFVK+ ++EL Sbjct: 2 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIRDFVKEAQDEL 56 >ref|XP_022859704.1| endoribonuclease Dicer homolog 1 [Olea europaea var. sylvestris] Length = 1321 Score = 70.5 bits (171), Expect = 2e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 +LPPG DLRAAAV KHNLHVHLR GS+ALEKQIRDFVK+V+NEL Sbjct: 1039 ELPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSTALEKQIRDFVKEVQNEL 1093 >gb|OTG38556.1| putative dicer-like 1 [Helianthus annuus] Length = 1710 Score = 70.1 bits (170), Expect = 3e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+VE+E+ Sbjct: 1428 DLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVESEV 1482 >ref|XP_021987907.1| LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 1-like [Helianthus annuus] Length = 1853 Score = 70.1 bits (170), Expect = 3e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+VE+E+ Sbjct: 1571 DLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVESEV 1625 >ref|XP_023753673.1| endoribonuclease Dicer homolog 1 [Lactuca sativa] Length = 1918 Score = 70.1 bits (170), Expect = 3e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+VE+E+ Sbjct: 1628 DLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVESEV 1682 >gb|PLY93172.1| hypothetical protein LSAT_3X140760 [Lactuca sativa] Length = 1921 Score = 70.1 bits (170), Expect = 3e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLH+HLR GSSALEKQIRDFVK+VE+E+ Sbjct: 1631 DLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVESEV 1685 >ref|XP_018840835.1| PREDICTED: endoribonuclease Dicer homolog 1 [Juglans regia] Length = 1995 Score = 69.7 bits (169), Expect = 4e-11 Identities = 37/55 (67%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -3 Query: 332 DLPPGHFNDLRAAAV----------KHNLHVHLRLGSSALEKQIRDFVKKVENEL 198 DLPPG DLRAAAV KHNLHVHLR GSSALEKQIRDFVK+ ++EL Sbjct: 1715 DLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIRDFVKEAQDEL 1769