BLASTX nr result
ID: Chrysanthemum22_contig00040480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040480 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF86241.1| Protein of unknown function (DUF707) [Helianthus ... 56 2e-06 >gb|OTF86241.1| Protein of unknown function (DUF707) [Helianthus annuus] Length = 439 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +1 Query: 232 SHQPVQSNMGRISHSVMGRRS-NETMRLIVTTFISVVIGFFLGV 360 ++Q VQ+NMG S +GRRS NET+R+IVTTFIS+V GFFLGV Sbjct: 31 TNQTVQNNMGTNIRSGIGRRSSNETLRIIVTTFISIVFGFFLGV 74