BLASTX nr result
ID: Chrysanthemum22_contig00040471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040471 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989337.1| CRIB domain-containing protein RIC6-like [He... 55 1e-06 >ref|XP_021989337.1| CRIB domain-containing protein RIC6-like [Helianthus annuus] ref|XP_021989339.1| CRIB domain-containing protein RIC6-like [Helianthus annuus] gb|OTG12030.1| putative CRIB domain-containing protein [Helianthus annuus] Length = 177 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 266 MGSGDPVLIQNRTPLKMGTIKVKGLLKGLRYISQVF 373 MGS DP+LIQ PLKM KVKGLLKGLRYISQVF Sbjct: 1 MGSKDPLLIQTIIPLKMNAHKVKGLLKGLRYISQVF 36