BLASTX nr result
ID: Chrysanthemum22_contig00040301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040301 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021977298.1| uncharacterized protein LOC110872741 [Helian... 57 2e-06 >ref|XP_021977298.1| uncharacterized protein LOC110872741 [Helianthus annuus] gb|OTG18382.1| putative PLAC8 motif-containing protein [Helianthus annuus] Length = 460 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -2 Query: 131 SNEHTSSNNKTSTYLEFRKKLEWGFLKTTARQWIRSPMNMVLL 3 + H S NN TS + +FR+KL+W LK T ++WIR+PMNMVLL Sbjct: 14 NGSHGSVNNTTSRFHQFRRKLDWDCLKKTGKEWIRNPMNMVLL 56