BLASTX nr result
ID: Chrysanthemum22_contig00040152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00040152 (641 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022008842.1| receptor protein kinase CLAVATA1-like [Helia... 62 1e-07 >ref|XP_022008842.1| receptor protein kinase CLAVATA1-like [Helianthus annuus] gb|OTF97117.1| putative leucine-rich receptor-like protein kinase family protein [Helianthus annuus] Length = 1026 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 320 TLFLGGNFFSGELLEEYSGFPSLKSLGLQGNDLSAT 427 TLFLGGNFFSGE+ EEYS FP LK+LGLQGN+LS T Sbjct: 228 TLFLGGNFFSGEIPEEYSEFPYLKNLGLQGNELSGT 263