BLASTX nr result
ID: Chrysanthemum22_contig00039896
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039896 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021972277.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 1e-06 ref|XP_021972273.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 1e-06 gb|OTF92288.1| putative FBD domain-containing protein [Helianthu... 54 1e-06 gb|OTG19840.1| putative F-box domain, FBD domain, Leucine-rich r... 55 3e-06 ref|XP_021972341.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 54 7e-06 ref|XP_021972345.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 54 7e-06 ref|XP_021972437.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 54 1e-05 ref|XP_022015260.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 54 1e-05 >ref|XP_021972277.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Helianthus annuus] Length = 380 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL K RI++ +++ KDE R+ +LL SP AS + IIV Sbjct: 328 ELDFVKLILAKSPVLKKARILMWDEIDKDEKLRISNILLSSPCASPVVKIIV 379 >ref|XP_021972273.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Helianthus annuus] Length = 414 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL K RI++ +++ KDE R+ +LL SP AS + IIV Sbjct: 362 ELDFVKLILAKSPVLKKARILMWDEIDKDEKLRISNILLSSPCASPVVKIIV 413 >gb|OTF92288.1| putative FBD domain-containing protein [Helianthus annuus] Length = 126 Score = 53.9 bits (128), Expect = 1e-06 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL KVRI+L ++ KDE R+ +M L SP AS + + V Sbjct: 74 ELDFVKLILAKSPVLKKVRILLWDQFDKDERLRISQMFLHSPCASPVVKLSV 125 >gb|OTG19840.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 1237 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL K RI++ +++ KDE R+ +LL SP AS + II+ Sbjct: 719 ELDFVKLILAKSPVLKKARILMWDEIDKDEKLRISNILLSSPCASPVVKIIM 770 >ref|XP_021972341.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972342.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972343.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] gb|OTG19870.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 377 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL K RI++ +++ KDE R+ +LL SP AS + I V Sbjct: 325 ELDFVKLILAKSPVLKKARILMWDEIDKDEKLRISNILLSSPCASPVVKISV 376 >ref|XP_021972345.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] ref|XP_021972346.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] gb|OTG19873.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 398 Score = 54.3 bits (129), Expect = 7e-06 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIVE 237 E++FVK+ILAKSP+L KV+I L N+V KDE + +L SP AS + + VE Sbjct: 333 ELDFVKVILAKSPMLKKVKIFLYNEVAKDEALHISGILKQSPHASSVVEFFVE 385 >ref|XP_021972437.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] gb|OTG19958.1| putative F-box domain, FBD domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 380 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGSPRASQMADIIV 240 E++FVKLILAKSPVL K RI++ +++ KDE R+ +LL SP AS + + V Sbjct: 328 ELDFVKLILAKSPVLKKARILVWDEIDKDENLRISNILLSSPCASPVVKLSV 379 >ref|XP_022015260.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] Length = 393 Score = 53.9 bits (128), Expect = 1e-05 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 2/57 (3%) Frame = -1 Query: 395 EMEFVKLILAKSPVLMKVRIILKNKVTKDEGSRMCKMLLGS--PRASQMADIIVEHP 231 EMEFV+LI+AKSPVL KVRI+L + V+ DE +M + L+ + PRAS A + + P Sbjct: 334 EMEFVRLIMAKSPVLKKVRILLNDNVSVDEEVKMLRELVSNPIPRASPSAKLTIVRP 390